DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosbeta6 and PSMB8

DIOPT Version :9

Sequence 1:NP_524115.1 Gene:Prosbeta6 / 39855 FlyBaseID:FBgn0002284 Length:235 Species:Drosophila melanogaster
Sequence 2:NP_683720.2 Gene:PSMB8 / 5696 HGNCID:9545 Length:276 Species:Homo sapiens


Alignment Length:231 Identity:52/231 - (22%)
Similarity:102/231 - (44%) Gaps:31/231 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 PDYQVP-GMKHPDFSPYESNGG--------------SIVAIAGDDFAVIAADTRLSSGYNIHSRT 59
            |:..:| ||:..:|  ::|.||              :.:|.......:.|.|:|.|:|..|.:..
Human    40 PELALPRGMQPTEF--FQSLGGDGERNVQIEMAHGTTTLAFKFQHGVIAAVDSRASAGSYISALR 102

  Fly    60 QSKLFKLSPQTVLGSAGCWADTLSLTGSIKVRMQSYEHTHLRTMTTEAVAQMLSIAMYNRRFFPY 124
            .:|:.:::|..:...:||.||.......:....:.|...:...::..|.:::||..|...|....
Human   103 VNKVIEINPYLLGTMSGCAADCQYWERLLAKECRLYYLRNGERISVSAASKLLSNMMCQYRGMGL 167

  Fly   125 YVSNILAGIDNEGKGVVYSYDPIGHCEKATYRAGGTAGTLLQPVLDNQIGHK-NMNLEDADKIKL 188
            .:.:::.|.|.:|.|:.| .|..|........:.|:..|....|:|:  |:: |::.|:|..:  
Human   168 SMGSMICGWDKKGPGLYY-VDEHGTRLSGNMFSTGSGNTYAYGVMDS--GYRPNLSPEEAYDL-- 227

  Fly   189 TKERAVSVASDTFISAAERDIYTGDSVLINIITKDG 224
             ..||::.|:       .||.|:|..|.:..:.:||
Human   228 -GRRAIAYAT-------HRDSYSGGVVNMYHMKEDG 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosbeta6NP_524115.1 proteasome_beta_type_1 22..235 CDD:239726 48/218 (22%)
PRE1 24..225 CDD:223711 47/216 (22%)
PSMB8NP_683720.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..33
proteasome_beta_type_5 73..260 CDD:239730 44/196 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.