DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosbeta6 and PSMB5

DIOPT Version :9

Sequence 1:NP_524115.1 Gene:Prosbeta6 / 39855 FlyBaseID:FBgn0002284 Length:235 Species:Drosophila melanogaster
Sequence 2:NP_002788.1 Gene:PSMB5 / 5693 HGNCID:9542 Length:263 Species:Homo sapiens


Alignment Length:211 Identity:47/211 - (22%)
Similarity:89/211 - (42%) Gaps:13/211 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 PGMKHPDFSPYES-NGGSIVAIAGDDFAVIAADTRLSSGYNIHSRTQSKLFKLSPQTVLGSAGCW 78
            ||...|:....|. :|.:.:|.......::|||:|.::|..|.|:|..|:.:::|..:...||..
Human    44 PGWGVPEEPGIEMLHGTTTLAFKFRHGVIVAADSRATAGAYIASQTVKKVIEINPYLLGTMAGGA 108

  Fly    79 ADTLSLTGSIKVRMQSYEHTHLRTMTTEAVAQMLSIAMYNRRFFPYYVSNILAGIDNEGKGVVYS 143
            ||.......:..:.:.||..:...::..|.:::|:..:|..:.....:..::.|.|..|.|:.|.
Human   109 ADCSFWERLLARQCRIYELRNKERISVAAASKLLANMVYQYKGMGLSMGTMICGWDKRGPGLYYV 173

  Fly   144 YDPIGHCEKATYRAGGTAGTLLQPVLDNQIGHKNMNLEDADKIKLTKERAVSVASDTFISAAERD 208
            .........||:.. |:.......|:|....:           .|..|:|..:|......|..||
Human   174 DSEGNRISGATFSV-GSGSVYAYGVMDRGYSY-----------DLEVEQAYDLARRAIYQATYRD 226

  Fly   209 IYTGDSVLINIITKDG 224
            .|:|.:|.:..:.:||
Human   227 AYSGGAVNLYHVREDG 242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosbeta6NP_524115.1 proteasome_beta_type_1 22..235 CDD:239726 44/204 (22%)
PRE1 24..225 CDD:223711 44/202 (22%)
PSMB5NP_002788.1 proteasome_beta_type_5 60..247 CDD:239730 42/195 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.