Sequence 1: | NP_524115.1 | Gene: | Prosbeta6 / 39855 | FlyBaseID: | FBgn0002284 | Length: | 235 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_002785.1 | Gene: | PSMB2 / 5690 | HGNCID: | 9539 | Length: | 201 | Species: | Homo sapiens |
Alignment Length: | 196 | Identity: | 48/196 - (24%) |
---|---|---|---|
Similarity: | 83/196 - (42%) | Gaps: | 13/196 - (6%) |
- Green bases have known domain annotations that are detailed below.
Fly 32 IVAIAGDDFAVIAADTRLSSGYNIHSRTQSKLFKLSPQTVLGSAGCWADTLSLTGSIKVRMQSYE 96
Fly 97 HTHLRTMTTEAVAQML--SIAMYNRRFFPYYVSNILAGIDNEGKGVVYSYDPIGHCEKATYRAGG 159
Fly 160 TAGTLLQPVLDNQIGHKNMNLEDADKIKLTKERAVSVASDTFISAAERDIYTGDSVLINIITKDG 224
Fly 225 I 225 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Prosbeta6 | NP_524115.1 | proteasome_beta_type_1 | 22..235 | CDD:239726 | 48/196 (24%) |
PRE1 | 24..225 | CDD:223711 | 46/194 (24%) | ||
PSMB2 | NP_002785.1 | proteasome_beta_type_2 | 1..192 | CDD:239727 | 48/196 (24%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG0638 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |