DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosbeta6 and psma3

DIOPT Version :9

Sequence 1:NP_524115.1 Gene:Prosbeta6 / 39855 FlyBaseID:FBgn0002284 Length:235 Species:Drosophila melanogaster
Sequence 2:NP_001025358.1 Gene:psma3 / 564370 ZFINID:ZDB-GENE-050913-120 Length:255 Species:Danio rerio


Alignment Length:173 Identity:37/173 - (21%)
Similarity:64/173 - (36%) Gaps:17/173 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 NGGSIVAIAGDDFAVIAADTR-LSSGYNIHSRTQSKLFKLSPQTVLGSAGCWADTLSLTGSIKVR 91
            |..:.:.|...|..|...:.. ||..|  ...:..::|.:.....:..||..||..||:...:..
Zfish    33 NSSTAIGIRCKDGVVFGVEKLVLSKLY--EEGSNKRIFNIDRHVGMAVAGLLADARSLSEVAREE 95

  Fly    92 MQSYEHTHLRTMTTEAVAQMLSIAMYNRRFF------PYYVSNILAGIDNEGKGVVYSYDPIGHC 150
            ..|:...:...:..:.:|.  .:|||...:.      |:..|.||...|.:....:|..||.|  
Zfish    96 ASSFRSNYGHDIPLKHLAD--RVAMYVHAYTLYSAVRPFGCSFILGSYDEDDGPQLYMVDPSG-- 156

  Fly   151 EKATYRAGGTAGTLLQPVLDNQIGHKNMNLEDADKIKLTKERA 193
              ..|...|.|....:.....:|  :.:.::|....:|.||.|
Zfish   157 --IAYGYWGCAIGKAKQAAKTEI--EKLQMKDMTCRELVKEVA 195

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosbeta6NP_524115.1 proteasome_beta_type_1 22..235 CDD:239726 37/173 (21%)
PRE1 24..225 CDD:223711 37/173 (21%)
psma3NP_001025358.1 proteasome_alpha_type_3 5..217 CDD:239720 37/173 (21%)
PRE1 6..241 CDD:223711 37/173 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.