DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosbeta6 and Prosalpha2

DIOPT Version :9

Sequence 1:NP_524115.1 Gene:Prosbeta6 / 39855 FlyBaseID:FBgn0002284 Length:235 Species:Drosophila melanogaster
Sequence 2:NP_524328.1 Gene:Prosalpha2 / 41531 FlyBaseID:FBgn0086134 Length:234 Species:Drosophila melanogaster


Alignment Length:207 Identity:51/207 - (24%)
Similarity:79/207 - (38%) Gaps:24/207 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 SNGGSIVAIAGDDFAVIAADTRLSSG-YNIHSRTQSKLFKLSPQTVLGSAGCWADTLSLTGSIKV 90
            |.|...|.|...:..|||.:.:..|. |..||..:.::.......|....|  .|...|....:.
  Fly    30 SGGAPSVGIIASNGVVIATENKHKSPLYEQHSVHRVEMIYNHIGMVYSGMG--PDYRLLVKQARK 92

  Fly    91 RMQSYEHTHLRTMTTEAVAQMLSIAM--YNRR--FFPYYVSNILAGIDNEGKGVVYSYDPIG--H 149
            ..|:|..|:...:....:.|.::..|  |.:.  ..|:.||.::.|.||: :..:|..||.|  .
  Fly    93 IAQTYYLTYKEPIPVSQLVQRVATLMQEYTQSGGVRPFGVSLLICGWDND-RPYLYQSDPSGAYF 156

  Fly   150 CEKATYRAGGTAGTLLQPVLDNQIGHKNMNLEDADKIKLTKERAVSVASDTFISAAERDIYTGDS 214
            ..|||  |.|          .|.:..|.. ||......|..:.||..|..|.....|..: |.|:
  Fly   157 AWKAT--AMG----------KNAVNGKTF-LEKRYSEDLELDDAVHTAILTLKEGFEGKM-TADN 207

  Fly   215 VLINIITKDGIE 226
            :.|.|..::|.:
  Fly   208 IEIGICDQNGFQ 219

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosbeta6NP_524115.1 proteasome_beta_type_1 22..235 CDD:239726 51/207 (25%)
PRE1 24..225 CDD:223711 50/204 (25%)
Prosalpha2NP_524328.1 proteasome_alpha_type_2 6..231 CDD:239719 51/207 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441069
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11599
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.