DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosbeta6 and Prosbeta2R2

DIOPT Version :9

Sequence 1:NP_524115.1 Gene:Prosbeta6 / 39855 FlyBaseID:FBgn0002284 Length:235 Species:Drosophila melanogaster
Sequence 2:NP_649515.3 Gene:Prosbeta2R2 / 40621 FlyBaseID:FBgn0037296 Length:322 Species:Drosophila melanogaster


Alignment Length:237 Identity:52/237 - (21%)
Similarity:100/237 - (42%) Gaps:44/237 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 MKHPDFSPY------------------------ESN----GGSIVAIAGDDFAVIAADTRLSSGY 53
            ||:||.||:                        |.|    |.::|.|..|...:|.|::|.:||.
  Fly     9 MKYPDRSPFLCGPSGFTFDNCLRNKQLKENGLEEPNSFTTGTTVVGIVFDGGVIIGAESRATSGG 73

  Fly    54 NIHSRTQSKLFKLSPQTVLGSAGCWADTLSLTGSIKVRMQSYE-HTHLRTMTTEAVAQMLSIAMY 117
            .:.|:|..|:.:|........||...||.:|....:.:::.:. :|..|.:......||:...::
  Fly    74 IVFSKTCRKIIELQANIFAAGAGTARDTKALVELTRAQLELHRMNTGFRKVPVCCANQMIRQLLF 138

  Fly   118 NRRFFPYYVSN-ILAGIDNEGKGVVYSYDPIGHCEKATYRAGGTAGTLLQPVLDNQIGHKNMNLE 181
              ||.....:: |:.|.||.|..:..:... |..:.|.:.:.|:...:...:|:::..      |
  Fly   139 --RFNGNIDADMIIGGADNTGAHLFCTRSD-GSTDTAPFTSIGSGYQVSMSILESRWS------E 194

  Fly   182 DADKIKLTKERAVSVASDTFISAAERDIYTGDSVLINIITKD 223
            |     |::|.|.::|.|...:..:.|:.:|..|.:.::..|
  Fly   195 D-----LSEESACALACDAVAAGMKNDLCSGGKVSLCVVRCD 231

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosbeta6NP_524115.1 proteasome_beta_type_1 22..235 CDD:239726 48/232 (21%)
PRE1 24..225 CDD:223711 47/230 (20%)
Prosbeta2R2NP_649515.3 PRE1 9..228 CDD:223711 51/232 (22%)
proteasome_beta_type_7 50..239 CDD:239732 43/196 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441193
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_101631
Panther 1 1.100 - - P PTHR11599
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.740

Return to query results.
Submit another query.