DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosbeta6 and Prosbeta5R1

DIOPT Version :9

Sequence 1:NP_524115.1 Gene:Prosbeta6 / 39855 FlyBaseID:FBgn0002284 Length:235 Species:Drosophila melanogaster
Sequence 2:NP_611776.1 Gene:Prosbeta5R1 / 37690 FlyBaseID:FBgn0034842 Length:315 Species:Drosophila melanogaster


Alignment Length:183 Identity:41/183 - (22%)
Similarity:78/183 - (42%) Gaps:12/183 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 VIAADTRLSSGYNIHSRTQSKLFKLSPQTVLGSAGCWADTLSLTGSIKVRMQSYEHTHLRTMTTE 106
            ::.||:|.:||..|.|:|..|:.:|:...:...||..||.:.....:....:.::..:.:.||.:
  Fly    84 ILCADSRATSGQYIGSQTMRKIVELNDYMLGTLAGGAADCVYWDRVLAKECRLHQLRYRKRMTVD 148

  Fly   107 AVAQMLSIAMYNRRFFPYYVSNILAGIDNEGKGVVYSYDPIGHCEKATYRAGGTAGTLLQPVLDN 171
            ..|:::.......:.....:..:|||.|:||..::| .|..|........:.|:.......|||.
  Fly   149 TAARIICNISTEYKGMGLVMGMMLAGFDDEGPKLIY-VDSEGMRSHGQVFSVGSGSPYALGVLDT 212

  Fly   172 QIGHKNMNLEDADKIKLTKERAVSVASDTFISAAERDIYTGDSVLINIITKDG 224
              |:         :..|:.:.|..:|......|..:|.|:|..|.:..|..:|
  Fly   213 --GY---------RYDLSDQEAYDLARRAIYHATSKDAYSGGIVRLYHIHSEG 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosbeta6NP_524115.1 proteasome_beta_type_1 22..235 CDD:239726 41/183 (22%)
PRE1 24..225 CDD:223711 41/183 (22%)
Prosbeta5R1NP_611776.1 PTZ00488 39..272 CDD:185666 41/183 (22%)
proteasome_beta_type_5 72..259 CDD:239730 41/183 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45440974
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11599
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.