DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosbeta6 and Prosalpha5

DIOPT Version :9

Sequence 1:NP_524115.1 Gene:Prosbeta6 / 39855 FlyBaseID:FBgn0002284 Length:235 Species:Drosophila melanogaster
Sequence 2:NP_477202.2 Gene:Prosalpha5 / 36951 FlyBaseID:FBgn0016697 Length:244 Species:Drosophila melanogaster


Alignment Length:225 Identity:48/225 - (21%)
Similarity:90/225 - (40%) Gaps:49/225 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 GGSIVAIAGDDFAVIAADTRLSSGYNIHSRTQSKLFKLSPQTVLGSAGCWADTLSLTGSIKVRMQ 93
            |.:.:.|...:..|:|.:.|::|...:.| |..|:.::.......::|..||..:|....:|..|
  Fly    34 GSTAIGICTPEGVVLAVEKRITSPLMVPS-TVEKIVEVDKHIGCATSGLMADARTLIERARVECQ 97

  Fly    94 SYEHTHLRTMTTEAVAQMLS--------------IAMYNRRFFPYYVSNILAGIDNEGKGVVYSY 144
            ::...:...|:.|:.||.:|              .|..:|   |:.|:.:.|||: .|:..::..
  Fly    98 NHWFVYNERMSIESCAQAVSTLAIQFGDSGDSDGAAAMSR---PFGVAILFAGIE-AGQPQLWHM 158

  Fly   145 DPIG----HCEKATYRAGGTAGTLLQPVLDNQIGHKNMNLEDADKIKLTKERAVSVASDTFISAA 205
            ||.|    |..||.  ..|:.|.             ..||:|..:..||.:.|:.::.:|.....
  Fly   159 DPSGTFVRHGAKAI--GSGSEGA-------------QQNLQDLFRPDLTLDEAIDISLNTLKQVM 208

  Fly   206 ERDIYTGDSVLINIITKDGIEVRTLTLRQD 235
            |..           :....:||.|:|..::
  Fly   209 EEK-----------LNSTNVEVMTMTKERE 227

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosbeta6NP_524115.1 proteasome_beta_type_1 22..235 CDD:239726 48/223 (22%)
PRE1 24..225 CDD:223711 44/213 (21%)
Prosalpha5NP_477202.2 PRK03996 8..243 CDD:235192 48/225 (21%)
proteasome_alpha_type_5 8..222 CDD:239722 46/218 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45440996
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11599
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.