DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosbeta6 and Psma4

DIOPT Version :9

Sequence 1:NP_524115.1 Gene:Prosbeta6 / 39855 FlyBaseID:FBgn0002284 Length:235 Species:Drosophila melanogaster
Sequence 2:NP_058977.1 Gene:Psma4 / 29671 RGDID:61846 Length:261 Species:Rattus norvegicus


Alignment Length:231 Identity:49/231 - (21%)
Similarity:91/231 - (39%) Gaps:46/231 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 FSP----YE--------SNGGSIVAIAGDDFAVIAADTRLSSGYNIHSRT-----QSKLFKLSPQ 69
            |||    |:        .:.|:.:.|..:|..::||:.|     |||...     ..|::||:..
  Rat    12 FSPEGRLYQVEYAMEAIGHAGTCLGILANDGVLLAAERR-----NIHKLLDEVFFSEKIYKLNED 71

  Fly    70 TVLGSAGCWADTLSLTGSIKVRMQSYEHTHLRTMTTE-AVAQMLSIAMYNRRF---FPYYVSNIL 130
            .....||..:|...||..:::..|.|...:...:..| .|..:..|.....:|   .|:.||.:.
  Rat    72 MACSVAGITSDANVLTNELRLIAQRYLLQYQEPIPCEQLVTALCDIKQAYTQFGGKRPFGVSLLY 136

  Fly   131 AGIDNEGKGVVYSYDPIGHCEKATYRAGGTAGTLLQPVLDNQIGHKNMNLEDADKIKLTKERAVS 195
            .|.|......:|..||.|:       .||...|.:.   :|.....:|..:|..:.::|.:.|::
  Rat   137 IGWDKHYGFQLYQSDPSGN-------YGGWKATCIG---NNSAAAVSMLKQDYKEGEMTLKSALA 191

  Fly   196 VASDTFISAAERDIYTGDSVLINIITKDGIEVRTLT 231
            :|........:          ::.::.:.:|:.|||
  Rat   192 LAVKVLNKTMD----------VSKLSAEKVEIATLT 217

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosbeta6NP_524115.1 proteasome_beta_type_1 22..235 CDD:239726 49/231 (21%)
PRE1 24..225 CDD:223711 43/221 (19%)
Psma4NP_058977.1 proteasome_alpha_type_4 3..216 CDD:239721 46/228 (20%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 240..261
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.