DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosbeta6 and Psmb2

DIOPT Version :9

Sequence 1:NP_524115.1 Gene:Prosbeta6 / 39855 FlyBaseID:FBgn0002284 Length:235 Species:Drosophila melanogaster
Sequence 2:NP_036100.3 Gene:Psmb2 / 26445 MGIID:1347045 Length:201 Species:Mus musculus


Alignment Length:196 Identity:48/196 - (24%)
Similarity:83/196 - (42%) Gaps:13/196 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 IVAIAGDDFAVIAADTRLSSGYNIHSRTQSKLFKLSPQTVLGSAGCWADTLSLTGSIKVRMQSYE 96
            ::.|.|.|:.::|:|...:|..........|:||:|.:.:|...|...||:.....|:..:|.|:
Mouse     4 LIGIQGPDYVLVASDRVAASNIVQMKDDHDKMFKMSEKILLLCVGEAGDTVQFAEYIQKNVQLYK 68

  Fly    97 HTHLRTMTTEAVAQML--SIAMYNRRFFPYYVSNILAGIDNEGKGVVYSYDPIGHCEKATYRAGG 159
            ..:...::..|.|...  ::|...|...||:|:.:|||.|......:|..|.:....||.:.|.|
Mouse    69 MRNGYELSPTAAANFTRRNLADCLRSRTPYHVNLLLAGYDEHEGPALYYMDYLAALAKAPFAAHG 133

  Fly   160 TAGTLLQPVLDNQIGHKNMNLEDADKIKLTKERAVSVASDTFISAAERDIYTGDSVLINIITKDG 224
            ....|...:||...           ...:::||||.:.........:|.|....:..:.:|.|||
Mouse   134 YGAFLTLSILDRYY-----------TPTISRERAVELLRKCLEELQKRFILNLPTFSVRVIDKDG 187

  Fly   225 I 225
            |
Mouse   188 I 188

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosbeta6NP_524115.1 proteasome_beta_type_1 22..235 CDD:239726 48/196 (24%)
PRE1 24..225 CDD:223711 46/194 (24%)
Psmb2NP_036100.3 proteasome_beta_type_2 1..192 CDD:239727 48/196 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.