DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosbeta6 and Psma1

DIOPT Version :9

Sequence 1:NP_524115.1 Gene:Prosbeta6 / 39855 FlyBaseID:FBgn0002284 Length:235 Species:Drosophila melanogaster
Sequence 2:NP_036095.1 Gene:Psma1 / 26440 MGIID:1347005 Length:263 Species:Mus musculus


Alignment Length:210 Identity:49/210 - (23%)
Similarity:76/210 - (36%) Gaps:38/210 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 GGSIVAIAGDDFAVIAADTRLSSGYNIHSRTQSKLFKLSPQTVLGSAGCWADTLSLTGSIKVRMQ 93
            |.:.|.:.....||:.|..|..|....|   |.|:..:.....:..||..||...|...::....
Mouse    32 GSATVGLKSKTHAVLVALKRAQSELAAH---QKKILHVDNHIGISIAGLTADARLLCNFMRQECL 93

  Fly    94 SYEHTHLRTMTTEAVAQMLS------IAMYNRRFFPYYVSNILAGIDNEGKGVVYSYDPIGHCEK 152
            .......|.:....:..::.      ...|.||  ||.|..::||.|:.|..:..:      |..
Mouse    94 DSRFVFDRPLPVSRLVSLIGSKTQIPTQRYGRR--PYGVGLLIAGYDDMGPHIFQT------CPS 150

  Fly   153 ATY---RA------GGTAGTLLQPVLDNQIGHKNMNLEDADKIKLTKERAVSVASDTFISAAERD 208
            |.|   ||      ..:|.|.|:..:..   ....||::..|..|...|      :|.  .||:|
Mouse   151 ANYFDCRAMSIGARSQSARTYLERHMSE---FMECNLDELVKHGLRALR------ETL--PAEQD 204

  Fly   209 IYTGDSVLINIITKD 223
            : |..:|.|.|:.||
Mouse   205 L-TTKNVSIGIVGKD 218

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosbeta6NP_524115.1 proteasome_beta_type_1 22..235 CDD:239726 49/210 (23%)
PRE1 24..225 CDD:223711 49/210 (23%)
Psma1NP_036095.1 proteasome_alpha_type_1 6..216 CDD:239718 47/206 (23%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 232..263
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.