DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosbeta6 and Psmb8

DIOPT Version :9

Sequence 1:NP_524115.1 Gene:Prosbeta6 / 39855 FlyBaseID:FBgn0002284 Length:235 Species:Drosophila melanogaster
Sequence 2:NP_542945.2 Gene:Psmb8 / 24968 RGDID:3426 Length:276 Species:Rattus norvegicus


Alignment Length:235 Identity:53/235 - (22%)
Similarity:99/235 - (42%) Gaps:35/235 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 QFPDYQVP-GMKHPDF-----SPYE-------SNGGSIVAIAGDDFAVIAADTRLSSGYNIHSRT 59
            |.|:..:| ||:..:|     ...|       ::|.:.:|.......::|.|:|.|:|..|.:..
  Rat    38 QAPELALPRGMQPTEFLRSFGDDQERKVQIEMAHGTTTLAFKFQHGVIVAVDSRASAGSYIATIR 102

  Fly    60 QSKLFKLSPQTVLGSAGCWADTLSLTGSIKVRMQSYEHTHLRTMTTEAVAQMLSIAMYNRRFFPY 124
            .:|:.:::|..:...:||.||.......:....:.|...:...::..|.:::||..|...|....
  Rat   103 VNKVIEINPYLLGTMSGCAADCQYWERLLAKECRLYYLRNGERISVSAASKLLSNMMLQYRGMGL 167

  Fly   125 YVSNILAGIDNEGKGVVYSYDPIGHCEKATYRAG-----GTAGTLLQPVLDNQIGHKNMNLEDAD 184
            .:.:::.|.|.:|.|:.|..|      ..|..:|     |:..|....|:|:  |::.       
  Rat   168 SMGSMICGWDKKGPGLYYVDD------NGTRLSGQMFSTGSGNTYAYGVMDS--GYRQ------- 217

  Fly   185 KIKLTKERAVSVASDTFISAAERDIYTGDSVLINIITKDG 224
              .|:.|.|..:|....:.|..||.|:|..|.:..:.|||
  Rat   218 --DLSPEEAYDLARRAIVYATHRDSYSGGVVNMYHMKKDG 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosbeta6NP_524115.1 proteasome_beta_type_1 22..235 CDD:239726 48/220 (22%)
PRE1 24..225 CDD:223711 47/213 (22%)
Psmb8NP_542945.2 PTZ00488 40..271 CDD:185666 52/233 (22%)
proteasome_beta_type_5 73..260 CDD:239730 45/200 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.