DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosbeta6 and pbs-2

DIOPT Version :9

Sequence 1:NP_524115.1 Gene:Prosbeta6 / 39855 FlyBaseID:FBgn0002284 Length:235 Species:Drosophila melanogaster
Sequence 2:NP_493271.1 Gene:pbs-2 / 173168 WormBaseID:WBGene00003948 Length:277 Species:Caenorhabditis elegans


Alignment Length:213 Identity:47/213 - (22%)
Similarity:84/213 - (39%) Gaps:32/213 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 GMKHPDFSPYESNGGSIVAIAGDDFAVIAADTRLSSGYNIHSRTQSKLFKLSPQTVLGSAGCWAD 80
            |.|.|..:   |.|.:|||:|.....|:.||:|.::|..|..:...|:.||:.......||..||
 Worm    36 GGKAPKLT---STGTTIVAVAFKGGLVMGADSRATAGNIIADKHCEKVHKLTESIYACGAGTAAD 97

  Fly    81 ----TLSLTGSIKVRMQSYEHTHLRTMTTEAVAQMLSIAMYNRRFFPY--YVSN--ILAGIDNEG 137
                |..|:|::::         |...|......:.::....:..|.|  |:..  ::.|:|..|
 Worm    98 LDQVTKMLSGNLRL---------LELNTGRKARVITALRQAKQHLFNYQGYIGAYLLIGGVDPTG 153

  Fly   138 KGVVYSYDPIGHCEKATYRAGGTAGTLLQPVLDNQIGHKNMNLEDADKIKLTKERAVSVASDTFI 202
            .. :|.....|......:.|.|:.......:|:...           |:.:||:.|..:......
 Worm   154 PH-LYMCSANGTTMAFPFTAQGSGSYAAITILERDF-----------KVDMTKDEAEKLVQRALE 206

  Fly   203 SAAERDIYTGDSVLINII 220
            :....|..:|:|:.:.||
 Worm   207 AGMHGDNASGNSLNLVII 224

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosbeta6NP_524115.1 proteasome_beta_type_1 22..235 CDD:239726 44/207 (21%)
PRE1 24..225 CDD:223711 44/205 (21%)
pbs-2NP_493271.1 PRE1 43..228 CDD:223711 44/206 (21%)
proteasome_beta_type_7 47..235 CDD:239732 42/199 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.