DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosbeta6 and psmb5

DIOPT Version :9

Sequence 1:NP_524115.1 Gene:Prosbeta6 / 39855 FlyBaseID:FBgn0002284 Length:235 Species:Drosophila melanogaster
Sequence 2:XP_002941560.1 Gene:psmb5 / 100379732 XenbaseID:XB-GENE-975048 Length:257 Species:Xenopus tropicalis


Alignment Length:183 Identity:41/183 - (22%)
Similarity:83/183 - (45%) Gaps:12/183 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 VIAADTRLSSGYNIHSRTQSKLFKLSPQTVLGSAGCWADTLSLTGSIKVRMQSYEHTHLRTMTTE 106
            ::|.|:|.::|..|.|:|..|:.:::|..:...||..||.......:..:.:.||..:...::..
 Frog    66 IVAVDSRATAGAYIASQTVKKVIEINPYLLGTMAGGAADCSFWERLLARQCRIYELRNKERISVA 130

  Fly   107 AVAQMLSIAMYNRRFFPYYVSNILAGIDNEGKGVVYSYDPIGHCEKATYRAGGTAGTLLQPVLDN 171
            |.:::|:..:|..:.....:..::.|.|..|.|:.| .|..|:....:..:.|:.......|||.
 Frog   131 AASKLLANMVYQYKGMGLSMGTMICGWDKRGPGLYY-VDSEGNRVSGSVFSVGSGSMYAYGVLDR 194

  Fly   172 QIGHKNMNLEDADKIKLTKERAVSVASDTFISAAERDIYTGDSVLINIITKDG 224
            ...:: |.:|:|.::          |..:...|..||.|:|..|.:..:.:||
 Frog   195 GYNYE-MEVEEAQEL----------ARRSIYQATYRDAYSGGVVNLYHVREDG 236

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosbeta6NP_524115.1 proteasome_beta_type_1 22..235 CDD:239726 41/183 (22%)
PRE1 24..225 CDD:223711 41/183 (22%)
psmb5XP_002941560.1 proteasome_beta_type_5 54..241 CDD:239730 41/183 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.