DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4098 and NUDT9

DIOPT Version :9

Sequence 1:NP_660192.1 Gene:CG4098 / 39854 FlyBaseID:FBgn0036648 Length:307 Species:Drosophila melanogaster
Sequence 2:NP_076952.1 Gene:NUDT9 / 53343 HGNCID:8056 Length:350 Species:Homo sapiens


Alignment Length:278 Identity:144/278 - (51%)
Similarity:183/278 - (65%) Gaps:9/278 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 HLMCRNNMYPRSSVLRYPVSDEQVFWSEPFPDYCPPAYTAPHI-GGQVWADPPLPSDTFWPQWNQ 102
            |...|.:.||.|.|.|..|.:|:|.|...:.||.|..|||..: .|..||||.:....|.|::|:
Human    62 HNKARTSPYPGSKVERSQVPNEKVGWLVEWQDYKPVEYTAVSVLAGPRWADPQISESNFSPKFNE 126

  Fly   103 LDGQVNRESFHGAYNVQNGLPLNPIGRTGLTGRGSLGRWGPNHAADPIVTRWKRDDQGAIVANPT 167
            .||.|.|:|.:|.|.::||.|.||.|||||.|||.|||||||||||||:||||||..|..:.:|.
Human   127 KDGHVERKSKNGLYEIENGRPRNPAGRTGLVGRGLLGRWGPNHAADPIITRWKRDSSGNKIMHPV 191

  Fly   168 TGKNIIQMVAIQRSDNKLWAIPGGMVDPGENVSVTLKREFTEEALNFTDKANMVER--------F 224
            :||:|:|.|||:|.|...||||||||||||.:|.||||||.|||||...|.:..:|        .
Human   192 SGKHILQFVAIKRKDCGEWAIPGGMVDPGEKISATLKREFGEEALNSLQKTSAEKREIEEKLHKL 256

  Fly   225 FQAGGVQVYQGYVDDFRNTDNAWMETTALNFHDEDGSQVGQLELMAGDDASNVRWTDVDSNLKLH 289
            |....:.:|:|||||.||||||||||.|:|:|||.|..:..|.|.|||||..|:|.|::..|||:
Human   257 FSQDHLVIYKGYVDDPRNTDNAWMETEAVNYHDETGEIMDNLMLEAGDDAGKVKWVDINDKLKLY 321

  Fly   290 ANHADIVREVVIRRNAHW 307
            |:|:..::.|..:|:|||
Human   322 ASHSQFIKLVAEKRDAHW 339

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4098NP_660192.1 ADPRase_NUDT9 125..303 CDD:239642 105/185 (57%)
NUDT9NP_076952.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 53..77 6/14 (43%)
ADPRase_NUDT9 149..335 CDD:239642 105/185 (57%)
Nudix box 215..237 17/21 (81%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165152972
Domainoid 1 1.000 139 1.000 Domainoid score I4836
eggNOG 1 0.900 - - E1_KOG4195
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H11435
Inparanoid 1 1.050 294 1.000 Inparanoid score I2766
Isobase 1 0.950 - 0 Normalized mean entropy S3629
OMA 1 1.010 - - QHG52466
OrthoDB 1 1.010 - - D1186086at2759
OrthoFinder 1 1.000 - - FOG0007217
OrthoInspector 1 1.000 - - oto89974
orthoMCL 1 0.900 - - OOG6_106760
Panther 1 1.100 - - LDO PTHR13030
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X5323
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1615.720

Return to query results.
Submit another query.