DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4098 and spd-2

DIOPT Version :9

Sequence 1:NP_660192.1 Gene:CG4098 / 39854 FlyBaseID:FBgn0036648 Length:307 Species:Drosophila melanogaster
Sequence 2:NP_648906.1 Gene:spd-2 / 39850 FlyBaseID:FBgn0027500 Length:1146 Species:Drosophila melanogaster


Alignment Length:84 Identity:21/84 - (25%)
Similarity:27/84 - (32%) Gaps:33/84 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly   166 PTTGKNIIQMVAIQR--------SD-------NKLWAI-PGGMVDPGENV--------------- 199
            |.:...|:.:.||.:        ||       |.||.. .|...|.|||.               
  Fly   387 PPSSSEILSLSAIDKALRDIDLNSDTSTVEVVNHLWEHGRGNNYDDGENKENQSSNSHAERTSCG 451

  Fly   200 --SVTLKREFTEEALNFTD 216
              .:|....||:..||.||
  Fly   452 SNKLTDTMSFTDSVLNSTD 470

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4098NP_660192.1 ADPRase_NUDT9 125..303 CDD:239642 21/84 (25%)
spd-2NP_648906.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457915
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR13030
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.