DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4098 and Trpm2

DIOPT Version :9

Sequence 1:NP_660192.1 Gene:CG4098 / 39854 FlyBaseID:FBgn0036648 Length:307 Species:Drosophila melanogaster
Sequence 2:NP_612174.2 Gene:Trpm2 / 28240 MGIID:1351901 Length:1506 Species:Mus musculus


Alignment Length:310 Identity:112/310 - (36%)
Similarity:167/310 - (53%) Gaps:40/310 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 ENPLTSAQMMSSLVKPGIFRHLMCRNNMYPRSSVLRYPVSDEQVFWSEPFPDYCPPAYTAPHIGG 83
            :.|.....:...:.:||...|:..|:.:||.:.::|:||.:|:|.|:..|..|.||.|||..  .
Mouse  1216 DEPDAELSIRRKVEEPGDGYHVSARHLLYPNARIMRFPVPNEKVPWAAEFLIYDPPFYTAEK--D 1278

  Fly    84 QVWADPPLPSDTFWP----QWNQLDGQVNRESFHGAYNVQNGLPLNPIGRTGLTGRGSLGRWGPN 144
            ....||  ..||..|    .:|.:||..:|.||||.|.|:.|.||||:|||||.|||||..:|||
Mouse  1279 VALTDP--VGDTAEPLSKISYNVVDGPTDRRSFHGVYVVEYGFPLNPMGRTGLRGRGSLSWFGPN 1341

  Fly   145 HAADPIVTRWKRDDQGAIVANPTTGKNIIQMVAIQRSDNKLWAIPGGMVDPGENVSVTLKREFTE 209
            |...|:||||||:..|||.....  :.:::::.::...::.||:|||..:|||.:...|||...:
Mouse  1342 HTLQPVVTRWKRNQGGAICRKSV--RKMLEVLVMKLPRSEHWALPGGSREPGEMLPRKLKRVLRQ 1404

  Fly   210 EALNFTDKANMVERFFQA------GGVQVYQGYVDDFRNTDNAWMETTALNFH--DEDGSQVGQL 266
            |             |:.|      .|.:||:|||||.|||||||:||.|::.|  |::..::.:|
Mouse  1405 E-------------FWVAFETLLMQGTEVYKGYVDDPRNTDNAWIETVAVSIHFQDQNDMELKRL 1456

  Fly   267 E---------LMAGDDASNVRWTDVDSNLKLHANHADIVREVVIRRNAHW 307
            |         .:..|...:..|..||..:.|:|||..|:::|.....||:
Mouse  1457 EENLHTHDPKELTRDLKLSTEWQVVDRRIPLYANHKTILQKVASLFGAHF 1506

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4098NP_660192.1 ADPRase_NUDT9 125..303 CDD:239642 72/194 (37%)
Trpm2NP_612174.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..22
LSDAT_euk 140..363 CDD:423023
trp <716..1071 CDD:273311
Ion_trans 800..>976 CDD:395416
Nudix_Hydrolase 1322..1502 CDD:412381 72/194 (37%)
Nudix box. /evidence=ECO:0000255|PROSITE-ProRule:PRU00794 1386..1407 8/33 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4195
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.