DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment spd-2 and Nudt9

DIOPT Version :9

Sequence 1:NP_648906.1 Gene:spd-2 / 39850 FlyBaseID:FBgn0027500 Length:1146 Species:Drosophila melanogaster
Sequence 2:NP_083070.2 Gene:Nudt9 / 74167 MGIID:1921417 Length:350 Species:Mus musculus


Alignment Length:335 Identity:66/335 - (19%)
Similarity:104/335 - (31%) Gaps:130/335 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly   254 AMPTATLSTQALKKIAAPTSEIET---SVSNSVLAGDPDFSLGNYFQTRSENIWNIVSNSSPNRS 315
            |:.:.|:.:.|.:.:.||.:...|   .::.::::|.                 |....:|.|::
Mouse    18 ALASVTVRSSACRAVPAPRNTFPTCGFHLNANIMSGS-----------------NGAKENSHNKA 65

  Fly   316 RTNQPLLEPESNVTLDSVGEKTPQPDNKT-------------YTKTDAITGSNLG------RNLM 361
            ||:.   .|.|.|      |::..|:.|.             ||....:.|....      .|..
Mouse    66 RTSP---YPGSKV------ERSQVPNEKVGWLVEWQDYNPVEYTAVSVLAGPQWADPQISESNFS 121

  Fly   362 RKMQQDRIETALKSRNGLAAKETKRPPSSSEILSLSAIDKALRDIDLNSDTSTVEVVNHLWEHGR 426
            .|..:.......||:|||...|..||.:.:                  ..|..|         ||
Mouse   122 PKFNEKDGHVERKSQNGLYEIENGRPRNPA------------------GRTGLV---------GR 159

  Fly   427 GNNYDDGEN----------KENQSSN--SH------------AERTSCG-----------SNKLT 456
            |.....|.|          |.::|.|  :|            .:|..||           ..|::
Mouse   160 GLLGRWGPNHAADPIITRWKRDESGNKITHPVSGKCILQFVAIKRKDCGEWAIPGGMVDPGEKIS 224

  Fly   457 DTM--SFTDSVLNSTDFRHLQQSISRK-----PLSPLADHPQITISRADTDP--------VETEA 506
            .|:  .|.:..|||     ||:|.:.|     .|..|.....:.|.:...|.        :||||
Mouse   225 ATLKREFGEEALNS-----LQKSSAEKREIEEKLHALFSQEHLVIYKGYVDDPRNTDNAWMETEA 284

  Fly   507 EADIDEWPST 516
            ....||...|
Mouse   285 VNYHDETGET 294

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
spd-2NP_648906.1 None
Nudt9NP_083070.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 53..78 10/50 (20%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 117..153 10/53 (19%)
ADPRase_NUDT9 149..335 CDD:239642 35/178 (20%)
Nudix box 215..237 3/21 (14%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR13030
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.