DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment spd-2 and NUDT9

DIOPT Version :9

Sequence 1:NP_648906.1 Gene:spd-2 / 39850 FlyBaseID:FBgn0027500 Length:1146 Species:Drosophila melanogaster
Sequence 2:NP_076952.1 Gene:NUDT9 / 53343 HGNCID:8056 Length:350 Species:Homo sapiens


Alignment Length:382 Identity:70/382 - (18%)
Similarity:125/382 - (32%) Gaps:142/382 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly   110 LVTPATKGTNISFEPAEITGRSTLCQAGKQRRREKPSLSVAEILKSSFVEKARLLERKLQDASQA 174
            |:..|....::|...|.:|.||:.|:.             .:..::||                :
Human     5 LLGKALAAVSLSLALASVTIRSSRCRG-------------IQAFRNSF----------------S 40

  Fly   175 EASYHLS----RGSSSSLSDSFNCSRSLPRTADMSELSLNGGGGFSFGSASLAAEGQDESFAPAE 235
            .:.:||:    .||:.|..:|.|.:|:.|                               :..::
Human    41 SSWFHLNTNVMSGSNGSKENSHNKARTSP-------------------------------YPGSK 74

  Fly   236 LMQSKLVLGEISWAQEFTAMPTATLSTQALKKIAAPTSEIETSVSNSVLAG----DPDFSLGNY- 295
            :.:|::...::.|..|:          |..|.:.      .|:|  |||||    ||..|..|: 
Human    75 VERSQVPNEKVGWLVEW----------QDYKPVE------YTAV--SVLAGPRWADPQISESNFS 121

  Fly   296 ---------FQTRSENIWNIVSNSSPNR--SRTN----------------QPLLEPESNVTLDSV 333
                     .:.:|:|....:.|..|..  .||.                .|::   :....||.
Human   122 PKFNEKDGHVERKSKNGLYEIENGRPRNPAGRTGLVGRGLLGRWGPNHAADPII---TRWKRDSS 183

  Fly   334 GEKTPQPDNKTY-------TKTD----AITGSNL--GRNLMRKMQQDRIETALKSRNGLAAKETK 385
            |.|...|.:..:       .:.|    ||.|..:  |..:...::::..|.||.|....:|::.:
Human   184 GNKIMHPVSGKHILQFVAIKRKDCGEWAIPGGMVDPGEKISATLKREFGEEALNSLQKTSAEKRE 248

  Fly   386 RPPSSSEILSLS--AIDKALRDIDLNSDTSTVEVVNHLWEHGRGNNYDD--GENKEN 438
            ......::.|..  .|.|...|...|:|.:        |......||.|  ||..:|
Human   249 IEEKLHKLFSQDHLVIYKGYVDDPRNTDNA--------WMETEAVNYHDETGEIMDN 297

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
spd-2NP_648906.1 None
NUDT9NP_076952.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 53..77 7/54 (13%)
ADPRase_NUDT9 149..335 CDD:239642 31/160 (19%)
Nudix box 215..237 3/21 (14%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR13030
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.