DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment spd-2 and CG4098

DIOPT Version :10

Sequence 1:NP_648906.1 Gene:spd-2 / 39850 FlyBaseID:FBgn0027500 Length:1146 Species:Drosophila melanogaster
Sequence 2:NP_660192.1 Gene:CG4098 / 39854 FlyBaseID:FBgn0036648 Length:307 Species:Drosophila melanogaster


Alignment Length:84 Identity:21/84 - (25%)
Similarity:27/84 - (32%) Gaps:33/84 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly   387 PPSSSEILSLSAIDKALRDIDLNSDTSTVEVVNHLWEHGRGNNYDDGENKENQSSNSHAERTSCG 451
            |.:...|:.:.||.:        ||       |.||.. .|...|.|||.               
  Fly   166 PTTGKNIIQMVAIQR--------SD-------NKLWAI-PGGMVDPGENV--------------- 199

  Fly   452 SNKLTDTMSFTDSVLNSTD 470
              .:|....||:..||.||
  Fly   200 --SVTLKREFTEEALNFTD 216

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
spd-2NP_648906.1 None
CG4098NP_660192.1 NUDIX_ADPRase_Nudt9 125..303 CDD:467538 21/84 (25%)

Return to query results.
Submit another query.