DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment spd-2 and Nudt9

DIOPT Version :9

Sequence 1:NP_648906.1 Gene:spd-2 / 39850 FlyBaseID:FBgn0027500 Length:1146 Species:Drosophila melanogaster
Sequence 2:NP_001006992.1 Gene:Nudt9 / 305149 RGDID:1359522 Length:350 Species:Rattus norvegicus


Alignment Length:336 Identity:69/336 - (20%)
Similarity:105/336 - (31%) Gaps:132/336 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly   254 AMPTATLSTQALKKIAAPTSEIETSVSNSVLAGDPDFSLGNYFQTRSENIWNIVSNSSPNRSRTN 318
            |:.:.|:.:...:.|.||.              :|..|.|.:.:....:..|.|.::|.|::||:
  Rat    18 ALASVTVRSSGCRAIPAPR--------------NPFPSCGFHLKANIMSGSNGVKDNSHNKARTS 68

  Fly   319 QPLLEPESNVTLDSVGEKTPQPDNKT-------------YTKTDAITG----------SNLGRNL 360
            .   .|.|.|      |::..|:.|.             ||....:.|          |:.....
  Rat    69 P---YPGSKV------ERSKVPNEKVGWLVEWQDYNPVEYTAVSVLAGPQWADPQISESSFSPRF 124

  Fly   361 MRKMQQDRIETALKSRNGLAAKETKRPPSSSEILSLSAIDKALRDIDLNSDTSTVEVVNHLWEHG 425
            ..|  ...:|.  ||:|||...|..||.:.:                  ..|..|         |
  Rat   125 NEK--DGHVER--KSQNGLYEIENGRPRNPA------------------GRTGLV---------G 158

  Fly   426 RGNNYDDGEN----------KENQSSN--SH------------AERTSCG-----------SNKL 455
            ||.....|.|          |.::|.|  :|            .:|..||           ..|:
  Rat   159 RGLLGRWGPNHAADPIITRWKRDESGNKITHPVSGKCILQFVAIKRKDCGEWAIPGGMVDPGEKI 223

  Fly   456 TDTM--SFTDSVLNSTDFRHLQQSISRK-----PLSPLADHPQITISRADTDP--------VETE 505
            :.|:  .|.:..|||     ||:|.:.|     .|..|.....:.|.:...|.        :|||
  Rat   224 SATLKREFGEEALNS-----LQKSSAEKREIEEKLHALFSQEHLVIYKGYVDDPRNTDNAWMETE 283

  Fly   506 AEADIDEWPST 516
            |....||...|
  Rat   284 AVNYHDETGET 294

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
spd-2NP_648906.1 None
Nudt9NP_001006992.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 53..77 9/32 (28%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 116..153 11/58 (19%)
ADPRase_NUDT9 149..335 CDD:239642 35/178 (20%)
Nudix box 215..237 3/21 (14%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR13030
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.