DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment spd-2 and ndx-6

DIOPT Version :9

Sequence 1:NP_648906.1 Gene:spd-2 / 39850 FlyBaseID:FBgn0027500 Length:1146 Species:Drosophila melanogaster
Sequence 2:NP_495015.1 Gene:ndx-6 / 173916 WormBaseID:WBGene00003583 Length:260 Species:Caenorhabditis elegans


Alignment Length:216 Identity:42/216 - (19%)
Similarity:74/216 - (34%) Gaps:67/216 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   246 ISWAQEFTAMPTATLSTQALKKIAAPTSEIETSVSNSVLAGDPDFSLGNYFQTRSENIWNIVSNS 310
            :.|:||::..              .|.:..:..|..:|.| ||:..     :...:..||.:...
 Worm    30 VKWSQEWSGY--------------NPPAHTDPKVDGAVWA-DPEID-----EKTFQPSWNAIDGK 74

  Fly   311 SPNRSRTNQPLLEPESNVTLDSVGEKTPQPDNKTYTKTDAITGSNLGRNLMRKMQQDRIETALKS 375
            ....|...|...:|.:...|:.:|.                ||.: ||.|:.:...:.....:.|
 Worm    75 INRVSYVCQYSFDPVTLRPLNPIGR----------------TGLS-GRGLLGRWGPNHAADPIVS 122

  Fly   376 R---NG-LAAKETKRPPSS---------------SEILSLSAIDKALRDIDLNSDTSTVEVVNHL 421
            |   || |.....:|..:.               |:.|.....::|:..| ::|     |.::.|
 Worm   123 RTNDNGDLEFVAVQRHDNGEWAIPGGMVDAGEHVSQTLRREFAEEAMHGI-VDS-----ENLDEL 181

  Fly   422 WEHG----RGNNYDDGENKEN 438
            |.:|    || ..||..|.:|
 Worm   182 WNNGKELYRG-YVDDPRNTDN 201

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
spd-2NP_648906.1 None
ndx-6NP_495015.1 Nudix_Hydrolase 95..258 CDD:294304 27/131 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR13030
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.