DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Syx8 and STX8

DIOPT Version :9

Sequence 1:NP_524113.1 Gene:Syx8 / 39847 FlyBaseID:FBgn0036643 Length:232 Species:Drosophila melanogaster
Sequence 2:NP_004844.1 Gene:STX8 / 9482 HGNCID:11443 Length:236 Species:Homo sapiens


Alignment Length:229 Identity:59/229 - (25%)
Similarity:122/229 - (53%) Gaps:8/229 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 DSWDIEYEGCERLRHQLLVYLNQRQQLNPRTSQFVQLTSSIQTGIEQLAKDMKHLKVVLDNAITW 71
            |.|...|:...::..::...:.||.|...:..:..:||.:|:..::.|.:.:..||.:|..|::.
Human     4 DPWFSTYDSTCQIAQEIAEKIQQRNQYERKGEKAPKLTVTIRALLQNLKEKIALLKDLLLRAVST 68

  Fly    72 ETSPEEELQQRRIDWDRLTSQLREIREKFANSSRSNVPAASGSAWQDQDLGPGHSN------SSR 130
            ....:.|..:|:...|.|.::.|.:...|.|....  |....|:...::...|..|      ...
Human    69 HQITQLEGDRRQNLLDDLVTRERLLLASFKNEGAE--PDLIRSSLMSEEAKRGAPNPWLFEEPEE 131

  Fly   131 NTALDVEALKQKKTEMLAQQNEGLEVLSATLSRQRQLATQLGNEVEDQNNILDNLANAMDRVETG 195
            ...|..:.::|::.:::.:|:.||:.||:.:|||:|:..::|||:::||.|:|:|||.::..:..
Human   132 TRGLGFDEIRQQQQKIIQEQDAGLDALSSIISRQKQMGQEIGNELDEQNEIIDDLANLVENTDEK 196

  Fly   196 VQRETQSIGQVNRRDSTWGYWLVIIALFVAIIVV 229
            ::.||:.:..|:|:.::.|..:||:.|.|||:||
Human   197 LRNETRRVNMVDRKSASCGMIMVILLLLVAIVVV 230

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Syx8NP_524113.1 SNARE_Syntaxin8 147..205 CDD:277205 21/57 (37%)
STX8NP_004844.1 SNARE_Syntaxin8 152..204 CDD:277205 20/51 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 62 1.000 Domainoid score I10377
eggNOG 1 0.900 - - E1_KOG3202
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H37973
Inparanoid 1 1.050 98 1.000 Inparanoid score I5028
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54955
OrthoDB 1 1.010 - - D1455798at2759
OrthoFinder 1 1.000 - - FOG0003175
OrthoInspector 1 1.000 - - oto90482
orthoMCL 1 0.900 - - OOG6_103098
Panther 1 1.100 - - LDO PTHR19957
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5676
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1413.870

Return to query results.
Submit another query.