DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Syx8 and STX10

DIOPT Version :9

Sequence 1:NP_524113.1 Gene:Syx8 / 39847 FlyBaseID:FBgn0036643 Length:232 Species:Drosophila melanogaster
Sequence 2:NP_003756.1 Gene:STX10 / 8677 HGNCID:11428 Length:249 Species:Homo sapiens


Alignment Length:239 Identity:47/239 - (19%)
Similarity:113/239 - (47%) Gaps:43/239 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 CERLRHQLLVYLNQRQQLNPRTSQFVQLTSSIQTGIEQLAKDMKHLK----VVLDNAITWETSPE 76
            ||.|:....|   .|::|:       ..|:.::.|:..:..|::.|:    :|..|...::. |.
Human    29 CELLQESAAV---GREELD-------WTTNELRNGLRSIEWDLEDLEETIGIVEANPGKFKL-PA 82

  Fly    77 EELQQRRIDWDRLTSQLREIREKFANSS------RSNVPAASGSAWQDQDLGPGHSNSSRNTALD 135
            .:||:|::..:|:...::|:::...:.:      |:|....:|.        |. :..|.:..||
Human    83 GDLQERKVFVERMREAVQEMKDHMVSPTAVAFLERNNREILAGK--------PA-AQKSPSDLLD 138

  Fly   136 VEAL--------KQKKTEMLA--QQNEGLEVLSATLSRQRQLATQLGNEVEDQNNILDNLANAMD 190
            ..|:        :|:.|:.|.  :|::.||::|.::...:.::.::|.|:::|..:||..|..||
Human   139 ASAVSATSRYIEEQQATQQLIMDEQDQQLEMVSGSIQVLKHMSGRVGEELDEQGIMLDAFAQEMD 203

  Fly   191 RVET---GVQRETQSIGQVNRRDSTWGYWLVIIALFVAIIVVVF 231
            ..::   ||.|:...:..:......|....|::.:.:.:::::|
Human   204 HTQSRMDGVLRKLAKVSHMTSDRRQWCAIAVLVGVLLLVLILLF 247

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Syx8NP_524113.1 SNARE_Syntaxin8 147..205 CDD:277205 16/62 (26%)
STX10NP_003756.1 Syntaxin-6_N 13..103 CDD:286286 18/84 (21%)
SNARE_Syntaxin6 160..225 CDD:277204 15/64 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3202
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.