DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Syx8 and TLG1

DIOPT Version :9

Sequence 1:NP_524113.1 Gene:Syx8 / 39847 FlyBaseID:FBgn0036643 Length:232 Species:Drosophila melanogaster
Sequence 2:NP_010756.3 Gene:TLG1 / 852079 SGDID:S000002876 Length:224 Species:Saccharomyces cerevisiae


Alignment Length:234 Identity:52/234 - (22%)
Similarity:100/234 - (42%) Gaps:47/234 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 VYLNQRQQLNPRTSQFVQLTSSI-----QTGIEQLAKDMKHLKVVLDNA-ITWETSPEEELQQRR 83
            |..:.::||| |.:.::...::.     :..|:.:.||::...|.||.: |..:....|::..|.
Yeast    11 VVKDTKEQLN-RINNYITRHNTAGDDDQEEEIQDILKDVEETIVDLDRSIIVMKRDENEDVSGRE 74

  Fly    84 IDWDRLTSQLREIREKF----ANSSRSNVPAASGSAWQDQDLGPGHSNSSRNTAL----DVEALK 140
            .....:..||..::.:|    ..|:::.:|           |.....||:.||::    |.....
Yeast    75 AQVKNIKQQLDALKLRFDRRIQESTQTTIP-----------LEETVENSTLNTSMAENNDGGMSN 128

  Fly   141 QKKTEMLAQQNEGLEVLSATLSRQRQLATQLGNEVEDQNNILDNLANAMDRVETGVQRETQSIGQ 205
            ..:.:||.:|:..|:.:..|:......|..:|:|:|:|..:|||:...||.|...:.|       
Yeast   129 PFQEQMLREQDVHLDGIHKTMQNLHIQAQTMGDELENQGQLLDNMDEGMDGVVNKLAR------- 186

  Fly   206 VNRRDSTWGY------------WLVIIALFVAIIVVVFV 232
             .||...|.|            .|:|:.|.| ::|:.|:
Yeast   187 -GRRQLEWVYEKNKEKYDDCCIGLLIVVLIV-LLVLAFI 223

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Syx8NP_524113.1 SNARE_Syntaxin8 147..205 CDD:277205 16/57 (28%)
TLG1NP_010756.3 SNARE_NTD_Tlg1p-like 6..92 CDD:410570 16/81 (20%)
SNARE_Syntaxin6 135..200 CDD:277204 20/72 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3202
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.