DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Syx8 and SYN8

DIOPT Version :9

Sequence 1:NP_524113.1 Gene:Syx8 / 39847 FlyBaseID:FBgn0036643 Length:232 Species:Drosophila melanogaster
Sequence 2:NP_009388.2 Gene:SYN8 / 851219 SGDID:S000000012 Length:255 Species:Saccharomyces cerevisiae


Alignment Length:231 Identity:48/231 - (20%)
Similarity:97/231 - (41%) Gaps:34/231 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 QLNPRTSQFVQLTSSIQTGIEQLAKD------MKHLKVVLDNAITWETSPEEEL----QQRRIDW 86
            :|.|.::..|.|...:.:.:|.|.|.      :.....:||...  :|:.::||    ||...:.
Yeast    28 KLAPTSNDNVTLKRQLGSILELLQKCAPNDELISRYNTILDKIP--DTAVDKELYRFQQQVARNT 90

  Fly    87 DRLTSQ-LREIREKFANSSRSNVPAASGSAWQDQDLGPGHSNSSRNTALDVEALKQ--------- 141
            |.::.: |:::|  |.|.....|.........::...|......::..|..:...|         
Yeast    91 DEVSKESLKKVR--FKNDDELTVMYKDDDEQDEESPLPSTHTPYKDEPLQSQLQSQSQPQPPQPM 153

  Fly   142 --------KKTEMLAQQNEGLEVLSATLSRQRQLATQLGNEVEDQN-NILDNLANAMDRVETGVQ 197
                    .:.:.|.:|:..|..||.::.|...::..|.||:..|| ::|.:|.|.:|.....:.
Yeast   154 VSNQELFINQQQQLLEQDSHLGALSQSIGRTHDISLDLNNEIVSQNDSLLVDLENLIDNNGRNLN 218

  Fly   198 RETQSI-GQVNRRDSTWGYWLVIIALFVAIIVVVFV 232
            |.::|: |..|.|....|..::|:.|.|.:::::.|
Yeast   219 RASRSMHGFNNSRFKDNGNCVIILVLIVVLLLLLLV 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Syx8NP_524113.1 SNARE_Syntaxin8 147..205 CDD:277205 17/59 (29%)
SYN8NP_009388.2 SNARE_SYN8 167..236 CDD:277212 20/68 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003175
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_103098
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
32.860

Return to query results.
Submit another query.