DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Syx8 and SYP52

DIOPT Version :9

Sequence 1:NP_524113.1 Gene:Syx8 / 39847 FlyBaseID:FBgn0036643 Length:232 Species:Drosophila melanogaster
Sequence 2:NP_001321707.1 Gene:SYP52 / 844297 AraportID:AT1G79590 Length:264 Species:Arabidopsis thaliana


Alignment Length:202 Identity:41/202 - (20%)
Similarity:93/202 - (46%) Gaps:6/202 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 DSWDIEYEGCERLRHQLLVYLNQRQQLNPRTSQFVQLTSSIQTGIEQLAKDMKHLKVVLDNAITW 71
            |.|..||....:|...:...:::|...........:..|:|:..|..|...:..|:.:|......
plant    37 DPWMREYNEALKLSEDINGMMSERNASGLTGPDAQRRASAIRRKITILGTRLDSLQSLLVKVPGK 101

  Fly    72 ETSPEEELQQRRIDWDRLTSQLREIREKFANSSRSNVPAASGSAWQDQDLGPGHSNSSRNTALDV 136
            :...|:|:.:|:.....|.|:..::......|:.:|..:..|:     ||.|..: .:|.:.:|.
plant   102 QHVSEKEMNRRKDMVGNLRSKTNQVASALNMSNFANRDSLFGT-----DLKPDDA-INRVSGMDN 160

  Fly   137 EALKQKKTEMLAQQNEGLEVLSATLSRQRQLATQLGNEVEDQNNILDNLANAMDRVETGVQRETQ 201
            :.:...:.:::.:|:||||.|..|:...:.:|..:..|:..|..::|:|...:|..::.::|..:
plant   161 QGIVVFQRQVMREQDEGLEKLEETVMSTKHIALAVNEELTLQTRLIDDLDYDVDITDSRLRRVQK 225

  Fly   202 SIGQVNR 208
            |:..:|:
plant   226 SLALMNK 232

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Syx8NP_524113.1 SNARE_Syntaxin8 147..205 CDD:277205 15/57 (26%)
SYP52NP_001321707.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3202
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54955
OrthoDB 1 1.010 - - D1455798at2759
OrthoFinder 1 1.000 - - FOG0003175
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_103098
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
87.690

Return to query results.
Submit another query.