DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Syx8 and SYP61

DIOPT Version :9

Sequence 1:NP_524113.1 Gene:Syx8 / 39847 FlyBaseID:FBgn0036643 Length:232 Species:Drosophila melanogaster
Sequence 2:NP_564310.1 Gene:SYP61 / 839749 AraportID:AT1G28490 Length:245 Species:Arabidopsis thaliana


Alignment Length:226 Identity:53/226 - (23%)
Similarity:96/226 - (42%) Gaps:58/226 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 QFVQLTSSIQTGIEQLAKDMKHLKVVLDNAIT-------WETSPEEELQQRRIDWDRLTSQLR-E 95
            :.|....||:..:::|.|           |||       |....|.||::||    |.||..| :
plant    45 ELVATCGSIEWQVDELEK-----------AITVAAKDPSWYGIDEAELEKRR----RWTSNARTQ 94

  Fly    96 IREKFANSSRSNVPAASGSAWQDQDLGPGHS-----------NSSRNTALD----------VEAL 139
            :|     :.:|.|.|...|:      |.||:           ||...:..|          |::.
plant    95 VR-----NVKSGVLAGKVSS------GAGHASEVRRELMRMPNSGEASRYDQYGGRDDDGFVQSE 148

  Fly   140 KQKKTEMLAQQNEGLEVLSATLSRQRQLATQLGNEVEDQNNILDNLANAMDRVETGVQRETQSIG 204
            ..::..::.||:|.|:.||.::.|...:...:.:|:..|..|:|.|...||..:..::...:.:|
plant   149 SDRQMLLIKQQDEELDELSKSVQRIGGVGLTIHDELVAQERIIDELDTEMDSTKNRLEFVQKKVG 213

  Fly   205 QVNRRDSTWGYWLVI---IALFVAIIVVVFV 232
            .|.::....|..::|   :.||:.:.|:||:
plant   214 MVMKKAGAKGQMMMICFLLVLFIILFVLVFL 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Syx8NP_524113.1 SNARE_Syntaxin8 147..205 CDD:277205 14/57 (25%)
SYP61NP_564310.1 SNARE_NTD_AtSYP61-like 5..102 CDD:410571 20/76 (26%)
SNARE_Qc 156..212 CDD:277194 14/55 (25%)
SNARE 189..240 CDD:399038 11/50 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3202
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.