DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Syx8 and SYP51

DIOPT Version :9

Sequence 1:NP_524113.1 Gene:Syx8 / 39847 FlyBaseID:FBgn0036643 Length:232 Species:Drosophila melanogaster
Sequence 2:NP_001031054.1 Gene:SYP51 / 838193 AraportID:AT1G16240 Length:232 Species:Arabidopsis thaliana


Alignment Length:233 Identity:50/233 - (21%)
Similarity:106/233 - (45%) Gaps:18/233 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 DSWDIEYEGCERLRHQLLVYLNQRQQLNPRTSQFVQLTSSIQTGIEQLAKDMKHLKVVLDNAITW 71
            |||...|....:|..::...:::|...........:..|:|:..|......:..|:.:|.. |..
plant     6 DSWMRAYNEALKLSEEINGMISERSSSAVTGPDAQRRASAIRRKITIFGNKLDSLQSLLAE-IHG 69

  Fly    72 ETSPEEELQQRRIDWDRLTSQLREIREKFANSSRSNVPAASGSAWQDQDLGPG---HSNSSRNTA 133
            :...|:|:.:|:    .:...||....:.||:..     .|..|.:|..|||.   ..:.||.|.
plant    70 KPISEKEMNRRK----DMVGNLRSKANQMANALN-----MSNFANRDSLLGPDIKPDDSMSRVTG 125

  Fly   134 LDVEALKQKKTEMLAQQNEGLEVLSATLSRQRQLATQLGNEVEDQNNILDNLANAMDRVETGVQR 198
            :|.:.:...:.:::.:|:||||.|..|:...:.:|..:..|::.|..::|:|...:|..::.::|
plant   126 MDNQGIVGYQRQVMREQDEGLEQLEGTVMSTKHIALAVSEELDLQTRLIDDLDYHVDVTDSRLRR 190

  Fly   199 ETQSIGQVNRR----DSTWGYWLVIIALFVAIIVVVFV 232
            ..:|:..:|:.    .|.....|.::.: |.:.||:::
plant   191 VQKSLAVMNKNMRSGCSCMSMLLSVLGI-VGLAVVIWM 227

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Syx8NP_524113.1 SNARE_Syntaxin8 147..205 CDD:277205 15/57 (26%)
SYP51NP_001031054.1 SNARE_Qc 139..196 CDD:277194 15/56 (27%)
SNARE 172..223 CDD:399038 9/51 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3202
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54955
OrthoDB 1 1.010 - - D1455798at2759
OrthoFinder 1 1.000 - - FOG0003175
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_103098
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
87.690

Return to query results.
Submit another query.