DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Syx8 and AT1G16230

DIOPT Version :9

Sequence 1:NP_524113.1 Gene:Syx8 / 39847 FlyBaseID:FBgn0036643 Length:232 Species:Drosophila melanogaster
Sequence 2:NP_001319019.1 Gene:AT1G16230 / 838192 AraportID:AT1G16230 Length:193 Species:Arabidopsis thaliana


Alignment Length:192 Identity:41/192 - (21%)
Similarity:89/192 - (46%) Gaps:11/192 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 DSWDIEYEGCERLRHQLLVYLNQRQQLNPRTSQFVQLTSSIQTGIEQLAKDMKHLKVVLDNAITW 71
            |||..|.....:|..::...:.:|..|...:|..::..||::..|..||..::.||.:|..: ..
plant     6 DSWIREQNETLKLSEEIDGMILERSSLAETSSYALRHASSMRRKITILATRVQTLKYLLAES-QG 69

  Fly    72 ETSPEEELQQRRIDWDRLTSQLREIREKFANSSRSNVPAASGSAWQDQDLGPGHSN-SSRNTALD 135
            ::...:|:.:|:..::.|.|:..::.........||:         |..|.|...: .||...||
plant    70 KSISGKEMSRRKGTFENLRSKANQMASALDMLKFSNI---------DILLRPEKDDIMSRVIGLD 125

  Fly   136 VEALKQKKTEMLAQQNEGLEVLSATLSRQRQLATQLGNEVEDQNNILDNLANAMDRVETGVQ 197
            .:.:.....:::.:.:|.|::|..|:.|.:..|..:..::..|..::|.|.:.:|..::||:
plant   126 NQGIVGLHRQVMKEHDEALDMLEETVMRVKHNALVMNEQIGLQTRLIDGLDHHVDVSDSGVR 187

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Syx8NP_524113.1 SNARE_Syntaxin8 147..205 CDD:277205 12/51 (24%)
AT1G16230NP_001319019.1 SNARE_Qc 137..187 CDD:277194 11/49 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3202
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54955
OrthoDB 1 1.010 - - D1455798at2759
OrthoFinder 1 1.000 - - FOG0003175
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
65.880

Return to query results.
Submit another query.