DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Syx8 and SYP71

DIOPT Version :9

Sequence 1:NP_524113.1 Gene:Syx8 / 39847 FlyBaseID:FBgn0036643 Length:232 Species:Drosophila melanogaster
Sequence 2:NP_566354.1 Gene:SYP71 / 820132 AraportID:AT3G09740 Length:266 Species:Arabidopsis thaliana


Alignment Length:277 Identity:53/277 - (19%)
Similarity:91/277 - (32%) Gaps:82/277 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 HDSWDIEYEGCERLRHQLLVYLNQRQQLNPRTSQFVQLTSSIQTGIEQ-------LAKDMKHLKV 63
            :|.:|::               .||:........|.:|..:.:|.||.       :.|:......
plant    17 YDKYDVD---------------KQREANISGDDAFARLYGAFETQIETALEKAELVTKEKNRAAA 66

  Fly    64 VLDNA--------ITWETSPEEELQQRRIDWDRLTSQLREIREKFANSSRSNVPA---------A 111
            |..||        ::.|....:.|..:|:  ..||::....|.....:..:.:.|         .
plant    67 VAMNAEIRRTKARLSEEVPKLQRLAVKRV--KGLTTEELAARNDLVLALPARIEAIPDGTAGGPK 129

  Fly   112 SGSAWQ------------------DQDLGPGHSNSSRNTALDVEALKQKKTEMLAQQNEGLEVLS 158
            |.|||.                  |.|... .||.|.....:.|..|.|:.:.|...:|||:.|.
plant   130 STSAWTPSSTTSRPDIKFDSDGRFDDDYFQ-ESNESSQFRQEYEMRKIKQEQGLDMISEGLDALK 193

  Fly   159 ATLSRQRQLATQLGNEVEDQNNILDNLANAMDRVETGVQRETQSI--------GQVNRRDSTWGY 215
                          |...|.|..||.....||.::|.|.|.|..:        ..||:..|:..:
plant   194 --------------NMASDMNEELDRQVPLMDEIDTKVDRATSDLKNTNVRLKDTVNQLRSSRNF 244

  Fly   216 WLVIIALFVAIIVVVFV 232
            .:.|:.|.:.:.:..::
plant   245 CIDIVLLCIVLGIAAYL 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Syx8NP_524113.1 SNARE_Syntaxin8 147..205 CDD:277205 16/65 (25%)
SYP71NP_566354.1 SNARE_Qc 177..232 CDD:277194 17/68 (25%)
SNARE 208..258 CDD:399038 11/49 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
21.870

Return to query results.
Submit another query.