DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Syx8 and Stx8

DIOPT Version :9

Sequence 1:NP_524113.1 Gene:Syx8 / 39847 FlyBaseID:FBgn0036643 Length:232 Species:Drosophila melanogaster
Sequence 2:XP_038942648.1 Gene:Stx8 / 59074 RGDID:61917 Length:253 Species:Rattus norvegicus


Alignment Length:220 Identity:52/220 - (23%)
Similarity:113/220 - (51%) Gaps:14/220 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 DSWDIEYEGCERLRHQLLVYLNQRQQLNPRTSQFVQLTSSIQTGIEQLAKDMKHLKVVLDNAITW 71
            |.|...|:...::..::...:.:|.|...|..:..:||.:|:|.::.|...:..||.:|..|::.
  Rat    28 DPWFSTYDSTCQIAQEIAEKIQERNQCERRGEKTPKLTLTIRTLLKNLKVKIDLLKDLLLRAVST 92

  Fly    72 ETSPEEELQQRRIDWDRLTSQLREIREKFANSSRSNVPAASGSAWQDQDLGPGHSN------SSR 130
            ....:.|..:|:...|.|.::.|.:...|.|  ..:.|....|:...::...|..|      ...
  Rat    93 RQITQLEGDRRQNLLDDLVTRERLLLASFKN--EGSEPDLIRSSLMSEEAKRGTPNPWLCEEPEE 155

  Fly   131 NTALDVEALKQKKTEMLAQQNEGLEVLSATLSRQRQLATQLGNEVEDQNNILDNLANAMDRVETG 195
            ...|..:.::|::.:::.:|:.||:.||:.:|||:|:..::|||:::||.|:|:|||.::..:..
  Rat   156 TRGLGFDEIRQQQQKIIQEQDAGLDALSSIISRQKQMGQEIGNELDEQNEIIDDLANLVENTDEK 220

  Fly   196 VQRETQSIGQVNRR----DSTWGYW 216
            ::.|.:.:..|:|:    :::|  |
  Rat   221 LRTEARRVTLVDRKSASCETSW--W 243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Syx8NP_524113.1 SNARE_Syntaxin8 147..205 CDD:277205 20/57 (35%)
Stx8XP_038942648.1 SNARE_Syntaxin8 176..230 CDD:277205 19/53 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3202
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H37973
Inparanoid 1 1.050 95 1.000 Inparanoid score I4961
OMA 1 1.010 - - QHG54955
OrthoDB 1 1.010 - - D1455798at2759
OrthoFinder 1 1.000 - - FOG0003175
OrthoInspector 1 1.000 - - oto97591
orthoMCL 1 0.900 - - OOG6_103098
Panther 1 1.100 - - LDO PTHR19957
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1312.840

Return to query results.
Submit another query.