DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Syx8 and stx6

DIOPT Version :9

Sequence 1:NP_524113.1 Gene:Syx8 / 39847 FlyBaseID:FBgn0036643 Length:232 Species:Drosophila melanogaster
Sequence 2:NP_001017879.1 Gene:stx6 / 550577 ZFINID:ZDB-GENE-030131-858 Length:256 Species:Danio rerio


Alignment Length:247 Identity:48/247 - (19%)
Similarity:105/247 - (42%) Gaps:53/247 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 LNQRQQLNPRTSQFVQ------------LTSSIQTGIEQLAKDMKHLKVVLDNAIT-WETSPEE- 77
            :|..|.|:.|..:.:|            .|:.::..:..:..|::.    ||..|: .|.:|:: 
Zfish    18 VNTAQGLHQRWIELLQDAGGASKEEVDWTTNELRNSLRSIEWDLED----LDETISIVEANPKKF 78

  Fly    78 -----ELQQRRIDWDRLTSQLREIREKFANSSRSNVP------------AASGSAWQDQDLGPGH 125
                 ||.:|:.........:||:::...:.....||            .:.|..||        
Zfish    79 NLDAMELAKRKAFITSTRQTVREMKDHMTSPMAITVPEKKNRQTLMGEGGSRGPIWQ-------- 135

  Fly   126 SNSSRNTALDVEAL---------KQKKTEMLAQ-QNEGLEVLSATLSRQRQLATQLGNEVEDQNN 180
            .:..:.|.||.|..         :|.:.:::|: |:|.||::|.|:...:.::.::|.|:::|..
Zfish   136 PSGEKYTRLDNELQTANSQFIEEQQTQQQLIAEKQDEHLELVSGTIGVLKNMSQRIGQELDEQAV 200

  Fly   181 ILDNLANAMDRVETGVQRETQSIGQVNRRDSTWGYWLVIIALFVAIIVVVFV 232
            :||:.::.||..::.:....:.:.:|:...|....|..|..|...:.||:.:
Zfish   201 MLDDFSHEMDSTQSRLDNVMKKLAKVSHMTSDKRQWCAIGVLLAILFVVILL 252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Syx8NP_524113.1 SNARE_Syntaxin8 147..205 CDD:277205 14/58 (24%)
stx6NP_001017879.1 Syntaxin-6_N 13..103 CDD:286286 17/88 (19%)
SNARE_Syntaxin6 168..232 CDD:277204 14/63 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3202
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.