DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Syx8 and Syx6

DIOPT Version :9

Sequence 1:NP_524113.1 Gene:Syx8 / 39847 FlyBaseID:FBgn0036643 Length:232 Species:Drosophila melanogaster
Sequence 2:NP_995816.1 Gene:Syx6 / 40373 FlyBaseID:FBgn0037084 Length:339 Species:Drosophila melanogaster


Alignment Length:305 Identity:51/305 - (16%)
Similarity:106/305 - (34%) Gaps:105/305 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 VYLNQRQQLNPRTSQFVQLTSSIQTGIEQLAKDMKHLKVVLDNAITWETSPEE------ELQQRR 83
            :||..|:......::....|:.::..:..:..|::.|:   |.....|.:|.:      ||..||
  Fly    40 LYLRWRELGENGGTEAEWTTTELRNSLRSIEWDLEDLE---DTISIVEKNPSKFRIDNRELSSRR 101

  Fly    84 IDWDRLTSQLREIREKFA-NSSRSNVPAASGSAWQDQDLGPGH--------SNSSRN-------- 131
            ...|....:::::::|.: |.||.....|......:....|.|        |||:.|        
  Fly   102 HFIDNTRDEVKQMKDKMSLNRSRDRDITAHQPLLDNDRHSPNHNHSIAIPNSNSNSNEYHQHPHN 166

  Fly   132 ------------------------------------------------TALD------------- 135
                                                            .|||             
  Fly   167 DRTYLVECPNGNSLINSGSQVANTIAGTMSAAAAAASRHSGTKYSKLENALDSPSHYGQTHHGGM 231

  Fly   136 ----------VEALKQKKTEMLAQQNEGLEVLSATLSRQRQLATQLGNEVEDQNNILDNLANAMD 190
                      ..:::|:   |:..|:|.|:::|.::...:.::.|:|.|:::|..:||:..|..|
  Fly   232 DSPSHRYVGETVSIQQR---MIQGQDEQLDMISDSIGTLKTVSRQIGVELDEQAVMLDDFGNEFD 293

  Fly   191 RVETGVQRETQSIGQV---NRRDSTWGYWLVI--IALFVAIIVVV 230
            ..|:.:....:.:.:|   |.....|...|::  :.|||.|:.::
  Fly   294 TTESKLDTTMKKVAKVLHMNNDKRQWAAILILSGLLLFVIILFII 338

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Syx8NP_524113.1 SNARE_Syntaxin8 147..205 CDD:277205 13/57 (23%)
Syx6NP_995816.1 Syntaxin-6_N 29..115 CDD:286286 14/77 (18%)
SNARE_Syntaxin6 250..315 CDD:277204 15/64 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3202
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.