DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Syx8 and stx8

DIOPT Version :9

Sequence 1:NP_524113.1 Gene:Syx8 / 39847 FlyBaseID:FBgn0036643 Length:232 Species:Drosophila melanogaster
Sequence 2:NP_956669.1 Gene:stx8 / 393346 ZFINID:ZDB-GENE-040426-1360 Length:235 Species:Danio rerio


Alignment Length:233 Identity:61/233 - (26%)
Similarity:122/233 - (52%) Gaps:15/233 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 DSWDIEYEGCERLRHQLLVYLNQRQQLNPRTSQFVQLTSSIQTGIEQLAKDMKHLKVVLDNAITW 71
            |.|...|:...||..::...:::|.:.........::..:::..:::|.:::..|:..|:.|...
Zfish     4 DLWLENYDAACRLAQEIAENIHERNRQQRTGGNPAKINMTLRASLQKLKQNIAQLRETLNRAAVQ 68

  Fly    72 ETSPEEELQQRRIDWDRLTSQLREIREKF------ANSSRSNVPA---ASGSAWQDQDLGPGHSN 127
            ....:.|..:|:...|.|.|:...:...|      |..|||.:.|   .||||     :.|...|
Zfish    69 RHIMQAEADRRQSLVDDLASRETRLNASFKGDITEAEPSRSTLMAGGNGSGSA-----VNPWLIN 128

  Fly   128 SSRNT-ALDVEALKQKKTEMLAQQNEGLEVLSATLSRQRQLATQLGNEVEDQNNILDNLANAMDR 191
            .|..| .|....:|.::.:::..|:.||:.|::.||||:|:..::|||:::||.|:|:||..:|:
Zfish   129 ESEETKGLSFGEIKNQQQQIIEAQDAGLDALASVLSRQKQMGQEIGNELDEQNEIIDDLAQLVDK 193

  Fly   192 VETGVQRETQSIGQVNRRDSTWGYWLVIIALFVAIIVV 229
            .:..::.||:.:..::.:.::.|..:||:.|.:|||||
Zfish   194 TDGRIKNETKRVKLLDSKSASCGMMVVIVLLLIAIIVV 231

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Syx8NP_524113.1 SNARE_Syntaxin8 147..205 CDD:277205 21/57 (37%)
stx8NP_956669.1 SNARE_Syntaxin8 149..207 CDD:277205 21/57 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 62 1.000 Domainoid score I10388
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H37973
Inparanoid 1 1.050 95 1.000 Inparanoid score I5054
OMA 1 1.010 - - QHG54955
OrthoDB 1 1.010 - - D1455798at2759
OrthoFinder 1 1.000 - - FOG0003175
OrthoInspector 1 1.000 - - oto39010
orthoMCL 1 0.900 - - OOG6_103098
Panther 1 1.100 - - LDO PTHR19957
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5676
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
1212.010

Return to query results.
Submit another query.