DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Syx8 and pfut-1

DIOPT Version :9

Sequence 1:NP_524113.1 Gene:Syx8 / 39847 FlyBaseID:FBgn0036643 Length:232 Species:Drosophila melanogaster
Sequence 2:NP_741744.2 Gene:pfut-1 / 180607 WormBaseID:WBGene00015793 Length:389 Species:Caenorhabditis elegans


Alignment Length:188 Identity:37/188 - (19%)
Similarity:63/188 - (33%) Gaps:71/188 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    81 QRRIDWDRLTSQLREIREKFANSSRSN----VPAASGSAW-----------------QDQDLGPG 124
            |:.:.|   :|::.|..:||.:::.:.    |...:.:.|                 .:|.||.|
 Worm   209 QKYLRW---SSRITEQAKKFISANLAKPFVAVHLRNDADWVRVCEHIDTTTNRPLFASEQCLGEG 270

  Fly   125 H---------SNSSRNTALD--VEA----------LKQKKTEMLAQQNEGLEVLSATLSRQR--Q 166
            |         .:.|:...|:  ||.          :...|..|:.:.||.|:.......||.  .
 Worm   271 HHLGTLTKEICSPSKQQILEQIVEKVGSIGAKSVFVASDKDHMIDEINEALKPYEIEAHRQEPDD 335

  Fly   167 LATQL----------GNEVEDQNNILDNLANAMDRVETGVQRETQSIGQVNRRDSTWG 214
            :.|.|          ||.|...::|              |:||....||..|..:.:|
 Worm   336 MYTSLAIMGRADLFVGNCVSTFSHI--------------VKRERDHAGQSPRPSAFFG 379

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Syx8NP_524113.1 SNARE_Syntaxin8 147..205 CDD:277205 14/69 (20%)
pfut-1NP_741744.2 O-FucT-1 27..381 CDD:211388 37/188 (20%)
O-FucT 37..374 CDD:287252 35/181 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3202
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.