DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Syx8 and stx10

DIOPT Version :9

Sequence 1:NP_524113.1 Gene:Syx8 / 39847 FlyBaseID:FBgn0036643 Length:232 Species:Drosophila melanogaster
Sequence 2:NP_001313376.1 Gene:stx10 / 100151249 ZFINID:ZDB-GENE-041111-53 Length:247 Species:Danio rerio


Alignment Length:231 Identity:50/231 - (21%)
Similarity:108/231 - (46%) Gaps:30/231 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 LNQRQQLNPRTSQFVQLTSSIQTGIEQLAKDMKHLKVVLDNAITW------------ETSP---- 75
            |::.|.|..|..:.:|..:.:..  ::|......|:..| .||.|            |.:|    
Zfish    18 LSKAQGLYERWEELLQEETPVSR--DELDWSTNELRNCL-RAIDWDLEDLHETISIVEANPGKFR 79

  Fly    76 --EEELQQRRIDWDRLTSQLREIREKF------ANSSRSNVPAASGSAWQDQDLGPGHSNSSRNT 132
              |.|||:||...:|....::.::|:.      |.:.:.|..|..|:..:|:..|......|.|:
Zfish    80 LGEHELQERRDFVERTRKSVQLMKEQLSSPSAVAQAEKKNKQALLGATAKDRYAGLEPHLVSANS 144

  Fly   133 ALDVEALKQKKTEMLAQ-QNEGLEVLSATLSRQRQLATQLGNEVEDQNNILDNLANAMDRVETGV 196
            ....|  :|::.:::.| |:|.||:::.::...:.:::::|:|:::|..:|......||:..:.:
Zfish   145 RYIQE--QQEQQQLIMQDQDEHLELVTGSIRVLKDMSSRIGDELDEQAVMLGEFNEEMDQTGSRM 207

  Fly   197 QRETQSIGQVNRRDSTWGYWLVIIALFVAIIVVVFV 232
            ....:.:.:|:...|:...|..|..|.:.:|||:.:
Zfish   208 DSVLKKMEKVSHMTSSRRQWCAIGVLVIILIVVLIL 243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Syx8NP_524113.1 SNARE_Syntaxin8 147..205 CDD:277205 11/58 (19%)
stx10NP_001313376.1 Syntaxin-6_N 13..103 CDD:312631 20/87 (23%)
SNARE_Syntaxin6 158..222 CDD:277204 12/63 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3202
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.