DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Syx8 and stx10

DIOPT Version :9

Sequence 1:NP_524113.1 Gene:Syx8 / 39847 FlyBaseID:FBgn0036643 Length:232 Species:Drosophila melanogaster
Sequence 2:NP_001120630.1 Gene:stx10 / 100145797 XenbaseID:XB-GENE-5854149 Length:250 Species:Xenopus tropicalis


Alignment Length:236 Identity:51/236 - (21%)
Similarity:111/236 - (47%) Gaps:37/236 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 CERLRHQLLVYLNQRQQLNPRTSQFVQLTSSIQTGIEQLAKDMKHLK----VVLDNAITWETSPE 76
            ||.|         |..|:. ...:|...|:.::..:..:..|::.|:    :|..|:..::.: .
 Frog    29 CELL---------QESQVT-SAEEFDWTTNELRNSLRSIEWDLEDLEETISIVESNSRKFKIT-G 82

  Fly    77 EELQQRRIDWDRLTSQLREIRE------KFANSSRSNVPAASGSAWQ---------DQDLGPGHS 126
            .||.:||...::..:.::|:|:      ..|.|.|.|.....|:..|         |:::..|:|
 Frog    83 TELSERRSFVEQTRNSVKEMRDHISSPRSLAFSERKNREVLLGAGQQPINDRFSRLDEEIISGNS 147

  Fly   127 NSSRNTALDVEALKQKKTEMLAQQNEGLEVLSATLSRQRQLATQLGNEVEDQNNILDNLANAMDR 191
            ..       ||..:.::..::..|:..||::|.::...:.:::::|:|:|:|..:||:..:.||.
 Frog   148 RY-------VEEQQAQQQLIIDGQDAELEMVSGSIRVLKDMSSRIGDELEEQTVMLDDFTHEMDN 205

  Fly   192 VETGVQRETQSIGQVNRRDSTWGYWLVIIALFVAIIVVVFV 232
            ..|.|....:.:.:|:...|....|.|||.|.:|:|:::.:
 Frog   206 TRTRVDSVFKRMAKVSHISSDRRQWCVIITLLLALIIILIL 246

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Syx8NP_524113.1 SNARE_Syntaxin8 147..205 CDD:277205 14/57 (25%)
stx10NP_001120630.1 Syntaxin-6_N 13..103 CDD:370343 16/84 (19%)
SNARE_Syntaxin6 161..226 CDD:277204 15/64 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.