DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment UQCR-C2 and UQCRC1

DIOPT Version :9

Sequence 1:NP_001261955.1 Gene:UQCR-C2 / 39846 FlyBaseID:FBgn0250814 Length:440 Species:Drosophila melanogaster
Sequence 2:NP_003356.2 Gene:UQCRC1 / 7384 HGNCID:12585 Length:480 Species:Homo sapiens


Alignment Length:460 Identity:107/460 - (23%)
Similarity:191/460 - (41%) Gaps:52/460 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 SLLRAIAKRGYATCPRPVGDLSAVNVKVLENKLVVATADATLPVSRVSLVLGAGSRNESYDIQGA 73
            :|||..|.|..||..:.:..:....|.:|:|.|.||:..::.|...|.:.:..|||.|:....||
Human    25 ALLRTPALRSTATFAQALQFVPETQVSLLDNGLRVASEQSSQPTCTVGVWIDVGSRFETEKNNGA 89

  Fly    74 SHLLRLAGGLSTQNSTAFAIARNIQQVGGTLTTWGDRELVGYTVTTTADNAETGLRYLQDLLQPA 138
            .:.|.......|:|....|:.:.::.:|..|..:..||...|.:...:.:....:..|.|::|..
Human    90 GYFLEHLAFKGTKNRPGSALEKEVESMGAHLNAYSTREHTAYYIKALSKDLPKAVELLGDIVQNC 154

  Fly   139 FKPWELVDNAKTVV---NQLNAVSTEERAIELVHKAAFR-NGLGNSIYSPRFQLGKLSSESLLHY 199
            ......::..:.|:   .|.|..|..:.....:|..||: ..|..::..|...:.|||...|..|
Human   155 SLEDSQIEKERDVILREMQENDASMRDVVFNYLHATAFQGTPLAQAVEGPSENVRKLSRADLTEY 219

  Fly   200 VAQTFAAGRAAVVGV-GIDNNTLAGFAQTLQFPSGG---SKAASA-------NWYGGDARKDTSG 253
            ::..:.|.|..:... |:::..|...||.   ..||   :.|..|       .:.|.:.|     
Human   220 LSTHYKAPRMVLAAAGGVEHQQLLDLAQK---HLGGIPWTYAEDAVPTLTPCRFTGSEIR----- 276

  Fly   254 HR--------AVVAVAGQGAAASNHKEALAFAILEQALGAKAATKRG---TSAGLFGEAVNCAGG 307
            ||        ..:||.|.|.|:.::   :|..:....:|....|..|   .|:.|...||  |..
Human   277 HRDDALPFAHVAIAVEGPGWASPDN---VALQVANAIIGHYDCTYGGGVHLSSPLASGAV--ANK 336

  Fly   308 VGASVKAVNASYSDAGLFGFVVSADSKDIGKTVEFLVRG---LKSASVSDKDVARGKALLKARII 369
            :..|.:..:..|::.||.|.....|...|...: |:::|   ....|.::.:|||||.:|:..::
Human   337 LCQSFQTFSICYAETGLLGAHFVCDRMKIDDMM-FVLQGQWMRLCTSATESEVARGKNILRNALV 400

  Fly   370 SRYSSDGGLIKEIGRQAALTRN----VLEADALLGAIDGISQSQVQE-AAKKVGSSKLAVGAIGH 429
            |.......:.::||| :.||..    :.|.::.:..:|.   |.|:| .:|.:.....||...|.
Human   401 SHLDGTTPVCEDIGR-SLLTYGRRIPLAEWESRIAEVDA---SVVREICSKYIYDQCPAVAGYGP 461

  Fly   430 LANVP 434
            :..:|
Human   462 IEQLP 466

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
UQCR-C2NP_001261955.1 PqqL 22..417 CDD:223685 96/428 (22%)
Peptidase_M16 41..185 CDD:279066 31/147 (21%)
Peptidase_M16_C 190..364 CDD:282978 48/198 (24%)
UQCRC1NP_003356.2 PqqL 41..469 CDD:223685 100/444 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0612
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.