DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rpn12 and PSMD8

DIOPT Version :9

Sequence 1:NP_648904.1 Gene:Rpn12 / 39845 FlyBaseID:FBgn0028693 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_002803.2 Gene:PSMD8 / 5714 HGNCID:9566 Length:350 Species:Homo sapiens


Alignment Length:259 Identity:130/259 - (50%)
Similarity:186/259 - (71%) Gaps:3/259 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LYKELTAEWSKRPPNTVKCGQLLDQLKVALVKMAFLPTDGNDAQSSKKQLILARSVLEVAVEHSV 71
            :|::|..||:::.||..|||:.|.:||:.|:::.||||.|  .:.:|:||||||.:||:..:.|:
Human    94 MYEQLKGEWNRKSPNLSKCGEELGRLKLVLLELNFLPTTG--TKLTKQQLILARDILEIGAQWSI 156

  Fly    72 LSKDLLAFERYMAQLKCYYYDYAKIIGESESKYKLLGLNLLYLLSGNRVSDFHTELELLSVDVIQ 136
            |.||:.:||||||||||||:||.:.:.||...::|||||||:|||.|||::||||||.|....||
Human   157 LRKDIPSFERYMAQLKCYYFDYKEQLPESAYMHQLLGLNLLFLLSQNRVAEFHTELERLPAKDIQ 221

  Fly   137 HNQFIRPILALEQYIMEGRYNKIFQAKSTVPVEVYSYFMDLLLETVRDEIGACIEKSYDKISAKD 201
            .|.:|:..::||||:|||.|||:|.||..:|.|.|::|:|:||:|:||||..||||:|:||...:
Human   222 TNVYIKHPVSLEQYLMEGSYNKVFLAKGNIPAESYTFFIDILLDTIRDEIAGCIEKAYEKILFTE 286

  Fly   202 AAKRLNLRVPDEIKAFGAKRQWKLEASGDYSFTDRSVKPKE-LLPSEELAEQVLSYARDLEMIV 264
            |.:.|....|.::..:..||.|.|..:..|||..:..||:: .:||.|||:||:.|||.|||||
Human   287 ATRILFFNTPKKMTDYAKKRGWVLGPNNYYSFASQQQKPEDTTIPSTELAKQVIEYARQLEMIV 350

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rpn12NP_648904.1 CSN8_PSD8_EIF3K 119..230 CDD:287089 52/110 (47%)
PSMD8NP_002803.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..24
CSN8_PSD8_EIF3K 201..315 CDD:370807 54/113 (48%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165144952
Domainoid 1 1.000 142 1.000 Domainoid score I4695
eggNOG 1 0.900 - - E1_KOG3151
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H37686
Inparanoid 1 1.050 264 1.000 Inparanoid score I3080
Isobase 1 0.950 - 0 Normalized mean entropy S2152
OMA 1 1.010 - - QHG53806
OrthoDB 1 1.010 - - D1183195at2759
OrthoFinder 1 1.000 - - FOG0003512
OrthoInspector 1 1.000 - - otm40647
orthoMCL 1 0.900 - - OOG6_102164
Panther 1 1.100 - - LDO PTHR12387
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1201
SonicParanoid 1 1.000 - - X2884
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1716.750

Return to query results.
Submit another query.