DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Smn and smndc1

DIOPT Version :9

Sequence 1:NP_001261954.1 Gene:Smn / 39844 FlyBaseID:FBgn0036641 Length:226 Species:Drosophila melanogaster
Sequence 2:NP_997766.1 Gene:smndc1 / 572679 ZFINID:ZDB-GENE-030131-614 Length:237 Species:Danio rerio


Alignment Length:147 Identity:35/147 - (23%)
Similarity:57/147 - (38%) Gaps:32/147 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 LVKTYDESVGLAREALARRLADSTNKREEENAAAAEEEAGEISATGGATSPEPVSFKVGDYARAT 79
            |.|...|.:.|.::.|..:.|:.|...:.....|...                 |::|||:..||
Zfish    35 LQKDLQEVIELTKDLLTSQPAEGTTSTKSSETVAPSH-----------------SWRVGDHCMAT 82

  Fly    80 Y-VDGVDYEGAVVSINEEKGTCVLRYLGYENEQEVLL--------------VDLLPSWGKRVRRE 129
            : .||..||..:..|:.|.||..:.:.||.|.:.:.|              :|..|...|.::.|
Zfish    83 WSQDGQVYEAEIEEIDNENGTAAITFAGYGNAEVMPLHMLKKVEEGRIRDEIDGKPKSKKELQAE 147

  Fly   130 QFLIAKKDEDEQLSRPK 146
            |....||...:::.|.|
Zfish   148 QREYKKKKAQKKVQRMK 164

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SmnNP_001261954.1 SMN 2..215 CDD:283622 35/147 (24%)
TUDOR 68..122 CDD:295375 20/68 (29%)
smndc1NP_997766.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 52..73 3/37 (8%)
TUDOR 76..124 CDD:119391 16/47 (34%)
Nuclear localization signal. /evidence=ECO:0000255 142..160 5/17 (29%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 149..198 4/16 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D539238at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.