DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Smn and smndc1

DIOPT Version :9

Sequence 1:NP_001261954.1 Gene:Smn / 39844 FlyBaseID:FBgn0036641 Length:226 Species:Drosophila melanogaster
Sequence 2:NP_001006857.1 Gene:smndc1 / 448621 XenbaseID:XB-GENE-491591 Length:238 Species:Xenopus tropicalis


Alignment Length:180 Identity:38/180 - (21%)
Similarity:79/180 - (43%) Gaps:49/180 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 LVKTYDESVGLAREALARRLADSTNKREEENAAAAEEEAGEISATGGATSPEPVSFKVGDYARAT 79
            |.|...|.:.|.::.|:.:.:::           |::...::||:|..      |:|||:...|.
 Frog    35 LKKDLQEVIELTKDLLSSQPSET-----------ADDACDDMSASGSQ------SWKVGEKCMAV 82

  Fly    80 YV-DGVDYEGAVVSINEEKGTCVLRYLGYENEQEVLLVDLLP-SWGKRVR---------REQFLI 133
            :. ||..||..:..|:||.||..:.:.||.|.:...|::|.| ..|::.:         :::.:.
 Frog    83 WSDDGQWYEAEIEEIDEENGTAAITFAGYGNAEVTSLLNLRPVEEGRKAKEDSGNLPMSKKEMIA 147

  Fly   134 AKKD--------------------EDEQLSRPKASAGSHSKTPKSS-RRS 162
            |:::                    ||:::...:.:..::||..|.. :||
 Frog   148 AQREYKKKKALKKAQRIKELEQEREDQKVKWQQFNNKAYSKNKKGQVKRS 197

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SmnNP_001261954.1 SMN 2..215 CDD:283622 38/180 (21%)
TUDOR 68..122 CDD:295375 20/55 (36%)
smndc1NP_001006857.1 SMN <66..>124 CDD:310529 22/63 (35%)
Nuclear localization signal. /evidence=ECO:0000255 142..160 1/17 (6%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D539238at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.