DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Smn and spf30

DIOPT Version :9

Sequence 1:NP_001261954.1 Gene:Smn / 39844 FlyBaseID:FBgn0036641 Length:226 Species:Drosophila melanogaster
Sequence 2:NP_588166.1 Gene:spf30 / 2538711 PomBaseID:SPCC1281.02c Length:311 Species:Schizosaccharomyces pombe


Alignment Length:201 Identity:35/201 - (17%)
Similarity:71/201 - (35%) Gaps:49/201 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 LLVKTYDESVGLAREALARRLADSTNK-REEENAAAAEEEAGEISATGGATS-PEPVSFKVGDYA 76
            ||.....|.:.|....|...:.:..|. :..:|..|           |..|| |..:.|..|:..
pombe    30 LLENDLKELISLTENLLQESVENDKNTFQNSQNGVA-----------GFNTSKPVHIDFTPGNLV 83

  Fly    77 RATYVDG--VDYEGAVVSIN----EEKGTCVLRYLGYENEQEVLL--VDLLP-------SWGKRV 126
            .|.:|.|  :.|...:.:::    .:|.|  :::|.|.:.:.|.|  :..:|       ...|.:
pombe    84 MARWVSGDYLFYPSRITAVSGFGANKKYT--VQFLDYPDIETVSLKHIKAMPEEKRQEIEGNKEI 146

  Fly   127 RREQFLIAKKDEDE--------QLSRPKASAGSHSKTPKSSRRSRISGGL-----------VMPP 172
            .::...|......|        .:|...::..|.:.:|.....:.::..:           .:|.
pombe   147 LKKSTTIRSTPVREPTKAISVASMSTSPSNYASRASSPDMKSSAAVTANVSPIQNVAQHVSTLPK 211

  Fly   173 MPPVPP 178
            :.|:||
pombe   212 ISPIPP 217

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SmnNP_001261954.1 SMN 2..215 CDD:283622 35/201 (17%)
TUDOR 68..122 CDD:295375 13/68 (19%)
spf30NP_588166.1 TUDOR 75..136 CDD:197660 13/62 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR13681
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.