DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Smn and Smn1

DIOPT Version :9

Sequence 1:NP_001261954.1 Gene:Smn / 39844 FlyBaseID:FBgn0036641 Length:226 Species:Drosophila melanogaster
Sequence 2:XP_011242939.1 Gene:Smn1 / 20595 MGIID:109257 Length:293 Species:Mus musculus


Alignment Length:274 Identity:71/274 - (25%)
Similarity:108/274 - (39%) Gaps:93/274 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 SDETNAAVWDDSLLVKTYDESVGLAREAL---------------ARRLADSTNKREEENAAAAEE 51
            ||:::  :|||:.|:|.||::|...:.||               |||.....||.:::|      
Mouse    25 SDDSD--IWDDTALIKAYDKAVASFKHALKNGDICETPDKPKGTARRKPAKKNKSQKKN------ 81

  Fly    52 EAGEISATGGATSPEPVSFKVGDYARATY-VDGVDYEGAVVSINEEKGTCVLRYLGYENEQEVLL 115
                      ||:|.. .:||||...|.: .||..|...:.||:.::.|||:.|.||.|.:|..|
Mouse    82 ----------ATTPLK-QWKVGDKCSAVWSEDGCIYPATITSIDFKRETCVVVYTGYGNREEQNL 135

  Fly   116 VDLL-PSWGKRVRREQFLIAKKDEDEQLSRPKASAGSHSKTPKSSRRSRI--------------- 164
            .||| |:.......||   ..::.:.|:|...:...|.|...|:..:|:.               
Mouse   136 SDLLSPTCEVANSTEQ---NTQENESQVSTDDSEHSSRSLRSKAHSKSKAAPWTSFLPPPPPMPG 197

  Fly   165 -----------------------------------SGGLVMPPMPPVPPMIVGQGDGAEQDFVAM 194
                                               ||..::||.||:.|..:...|.    ..:|
Mouse   198 SGLGPGKPGLKFNGPPPPPPLPPPPFLPCWMPPFPSGPPIIPPPPPISPDCLDDTDA----LGSM 258

  Fly   195 LTAWYMSGYYTGLY 208
            |.:||||||:||.|
Mouse   259 LISWYMSGYHTGYY 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SmnNP_001261954.1 SMN 2..215 CDD:283622 71/274 (26%)
TUDOR 68..122 CDD:295375 23/55 (42%)
Smn1XP_011242939.1 SMN 24..273 CDD:310529 71/274 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167843271
Domainoid 1 1.000 57 1.000 Domainoid score I10902
eggNOG 1 0.900 - - E1_KOG4327
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 74 1.000 Inparanoid score I5270
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG47795
OrthoDB 1 1.010 - - D1316275at2759
OrthoFinder 1 1.000 - - FOG0006496
OrthoInspector 1 1.000 - - oto94105
orthoMCL 1 0.900 - - OOG6_108123
Panther 1 1.100 - - LDO PTHR13681
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3285
SonicParanoid 1 1.000 - - X4739
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1514.800

Return to query results.
Submit another query.