DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nxf2 and NXF2B

DIOPT Version :9

Sequence 1:NP_524111.3 Gene:nxf2 / 39843 FlyBaseID:FBgn0036640 Length:841 Species:Drosophila melanogaster
Sequence 2:NP_001093156.1 Gene:NXF2B / 728343 HGNCID:23984 Length:626 Species:Homo sapiens


Alignment Length:625 Identity:141/625 - (22%)
Similarity:260/625 - (41%) Gaps:108/625 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   267 PANIKSLESNFELVDGKPFNMLHK----IFSPLDVEIDLEV-----DGARIDTNNMWKLPEFENS 322
            |::.:..:.:.|:.|      :||    ..:|..:..:..:     |..||.|....|.||.:.|
Human    55 PSHCQENDGSVEMRD------VHKDQQLRHTPYSIRCERRMKWHSEDEIRITTWRNRKPPERKMS 113

  Fly   323 Q--------HWHAFMIPDPSHEFNQEVFFDFFFIRLDPT-LSN---------FYPCYYKYINTEH 369
            |        :|....||              :.|:.|.. |.|         |.|..:.|:....
Human   114 QNTQDGYTRNWFKVTIP--------------YGIKYDKAWLMNSIQSHCSDRFTPVDFHYVRNRA 164

  Fly   370 VFLVRNCFDQIAHLVNNCNLEMTIPTGDRIFRYYLRMNVSTVK---QHHVDP--EECIQKAVSQC 429
            .|.|::.  ..|..:.:.:.::......:|..:   :|.||..   ::.:.|  .|.::..:::.
Human   165 CFFVQDA--SAASALKDVSYKIYDDENQKICIF---VNHSTAPYSVKNKLKPGQMEMLKLTMNKR 224

  Fly   430 YVAQNRMLNLE--RFHSRECLKDVMVSLSSPKILTYVLSVASRKFMTTCSEIRLCHNKVLVLDG- 491
            |....:.|:|:  ||......:|:.:.|:....:...|.:..|.|....| :.||:||:..||| 
Human   225 YNVSQQALDLQNLRFDPDLMGRDIDIILNRRNCMAATLKIIERNFPELLS-LNLCNNKLYQLDGL 288

  Fly   492 AHVLGMMGCLRAVDLSHNWVQDLSSIHSLGNLPLKSLVLHGNKLCRNYRLPSEYVRAVKEVFPQL 556
            :.:......::.::||.|.::....:..:..|.|:.|.|.||.||..:...|.||.|:::.||:|
Human   289 SDITEKAPKVKTLNLSKNKLESAWELGKVKGLKLEELWLEGNPLCSTFSDQSAYVSAIRDCFPKL 353

  Fly   557 TTLDG--------VDLQTNPG-QSLQKNFLCDTGAYELVGAFLENYLREFENDEFRHNLYKYYSE 612
            ..|||        ||:.::.. :..::||........||..||:.|...:::.: |..|...|.:
Human   354 LRLDGRELSAPVIVDIDSSETMKPCKENFTGSETLKHLVLQFLQQYYSIYDSGD-RQGLLGAYHD 417

  Fly   613 NSIFTLTCNYNVVQNHQTPK--ILQRLSKYNRHARNLRN-KD-YSKASDGVFFGCTY--IVEILL 671
            .:.|:|...::       ||  ....|.||...:||::. || |.|   |.....|.  ||:.|.
Human   418 EACFSLAIPFD-------PKDSAPSSLCKYFEDSRNMKTLKDPYLK---GELLRRTKRDIVDSLS 472

  Fly   672 QLPRVTHDFHSLQTDVMHYNGKGAVIYVAGLLRDEPPSTRNGHGSKTDIGGVLLGFSRQFVVTFD 736
            .||:..||..|:..||.....:.....|.|:.::....::          |.:|.|:|.|:.|..
Human   473 ALPKTQHDLSSILVDVWCQTERMLCFSVNGVFKEVEGQSQ----------GSVLAFTRTFIATPG 527

  Fly   737 EANLGLGKRARRLKIANERLHITNPSKTAIRNAFSVNFPDPSERQAEEDSLDVKDHKLL-LFQEV 800
            .::        .|.|.|:.|.:.:.|....::|||:  |..:...:.|.||..:..::: .|...
Human   528 SSS--------SLCIVNDELFVRDASPQETQSAFSI--PVSTLSSSSEPSLSQEQQEMVQAFSAQ 582

  Fly   801 TGLISTWVTSIVEEADWDFERALKLFIQKNADHEIPDLAF 840
            :|:...|....:::.:|::.||.:.|.....:.:||..||
Human   583 SGMKLEWSQKCLQDNEWNYTRAGQAFTMLQTEGKIPAEAF 622

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nxf2NP_524111.3 leucine-rich repeat 434..474 CDD:275382 9/41 (22%)
leucine-rich repeat 475..500 CDD:275382 8/25 (32%)
leucine-rich repeat 501..524 CDD:275382 3/22 (14%)
leucine-rich repeat 525..555 CDD:275382 12/29 (41%)
TAP_C 779..841 CDD:197882 14/63 (22%)
NXF2BNP_001093156.1 Tap-RNA_bind 121..203 CDD:312616 17/100 (17%)
leucine-rich repeat 229..271 CDD:275382 9/41 (22%)
LRR_8 270..332 CDD:316378 17/62 (27%)
LRR 1 271..296 8/25 (32%)
leucine-rich repeat 272..297 CDD:275382 8/25 (32%)
LRR 2 297..320 3/22 (14%)
leucine-rich repeat 298..321 CDD:275382 3/22 (14%)
LRR 3 321..348 11/26 (42%)
leucine-rich repeat 322..352 CDD:275382 12/29 (41%)
LRR 4 349..376 8/26 (31%)
NTF2_like 391..543 CDD:324324 45/180 (25%)
TAP_C 570..623 CDD:197882 11/53 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165147830
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D442228at33208
OrthoFinder 1 1.000 - - FOG0000862
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10662
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.950

Return to query results.
Submit another query.