DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nxf2 and NXF3

DIOPT Version :9

Sequence 1:NP_524111.3 Gene:nxf2 / 39843 FlyBaseID:FBgn0036640 Length:841 Species:Drosophila melanogaster
Sequence 2:NP_071335.1 Gene:NXF3 / 56000 HGNCID:8073 Length:531 Species:Homo sapiens


Alignment Length:465 Identity:93/465 - (20%)
Similarity:172/465 - (36%) Gaps:120/465 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   357 FYPCYYKYINTEHVFLVRNCFDQIAHLVNNCNLEMTIPTGDRIFRYYLRMNVSTVKQHHVDPEEC 421
            |.|..:.|.|....|.|.|.  .||:.:.|.:.::.....::|..:     |:.....|....|.
Human   141 FVPVEFHYENMHASFFVENA--SIAYALKNVSGKIWDEDNEKISIF-----VNPAGIPHFVHREL 198

  Fly   422 IQKAVSQCYVAQNRMLNLERFHSRECLKDVMVSLSSPKILTYVLSVAS--RKFMTTCSEIRLCHN 484
            ..:.|.|..:|.|:..::    |:|.| |:......|.::.....:||  ||.|....::     
Human   199 KSEKVEQIKLAMNQQCDV----SQEAL-DIQRLPFYPDMVNRDTKMASNPRKCMAASLDV----- 253

  Fly   485 KVLVLDGAHVLGMMGCLRAVDLSHNWVQDLSSIHSLGNLPLKSLVLHGNK------LCRNYRLPS 543
                                   |.  :::.::.|.|.:.....:..|.|      :|..:...|
Human   254 -----------------------HE--ENIPTVMSAGEMDKWKGIEPGEKCADRSPVCTTFSDTS 293

  Fly   544 EYVRAVKEVFPQLTTLDGVDLQTNPGQSLQKNFLCDTGAYE-----------------LVGAFLE 591
            ..:.::.|:||:|..|||   |.:|     :..||.|.|::                 ||..||:
Human   294 SNINSILELFPKLLCLDG---QQSP-----RATLCGTEAHKRLPTCKGSFFGSEMLKNLVLQFLQ 350

  Fly   592 NYLREFENDEFRHNLYKYYSENSIFTLTCNYNVVQNHQTPKILQRLSKYNRHARNLRNK------ 650
            .|...:::.: |..|...|.:.:.|:|:..:|  .....|....:..|.:|:.:.|::.      
Human   351 QYYLIYDSGD-RQGLLSAYHDEACFSLSIPFN--PEDSAPSSFCKFFKDSRNIKILKDPYLRGEL 412

  Fly   651 -DYSKASDGVFFGCTYIVEILLQLPRVTHDFHSLQTDVMHYNGKGAVIYVAGLLRDEPPSTRNGH 714
             .::|..         ||:.|..||:..||..|...|:.:.........|.|:.::....::   
Human   413 LKHTKLD---------IVDSLSALPKTQHDLSSFLVDMWYQTEWMLCFSVNGVFKEVEGQSQ--- 465

  Fly   715 GSKTDIGGVLLGFSRQFVVTFDEANLGLGKRARRLKIANERLHITNPSK--------TAIRNAFS 771
                   |.:|.|:|.|:.|...::        .|.|.|::|.:.:.|.        |.:..|||
Human   466 -------GSVLAFTRTFIATPGSSS--------SLCIVNDKLFVRDTSHQGTQSALFTLVPTAFS 515

  Fly   772 VNFPDPSERQ 781
            .:.|..|:.|
Human   516 SSVPAFSQEQ 525

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nxf2NP_524111.3 leucine-rich repeat 434..474 CDD:275382 10/41 (24%)
leucine-rich repeat 475..500 CDD:275382 0/24 (0%)
leucine-rich repeat 501..524 CDD:275382 3/22 (14%)
leucine-rich repeat 525..555 CDD:275382 6/35 (17%)
TAP_C 779..841 CDD:197882 1/3 (33%)
NXF3NP_071335.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 33..59
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 83..106
Tap-RNA_bind 110..192 CDD:312616 12/57 (21%)
noncanonical RNP-type RNA-binding (RBD) domain 115..192 12/57 (21%)
leucine-rich repeat (LRR) domains 193..329 35/178 (20%)
leucine-rich repeat 218..260 CDD:275382 10/72 (14%)
leucine-rich repeat 275..305 CDD:275382 6/29 (21%)
nuclear transport factor 2 (NTF2)-like domain 339..461 27/133 (20%)
NTF2 341..496 CDD:238403 37/184 (20%)
ubiquitin-associated domain 524..531 1/2 (50%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165147828
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3763
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D442228at33208
OrthoFinder 1 1.000 - - FOG0000862
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10662
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
76.810

Return to query results.
Submit another query.