Sequence 1: | NP_524111.3 | Gene: | nxf2 / 39843 | FlyBaseID: | FBgn0036640 | Length: | 841 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_731156.1 | Gene: | nxf4 / 40884 | FlyBaseID: | FBgn0051501 | Length: | 301 | Species: | Drosophila melanogaster |
Alignment Length: | 206 | Identity: | 47/206 - (22%) |
---|---|---|---|
Similarity: | 89/206 - (43%) | Gaps: | 43/206 - (20%) |
- Green bases have known domain annotations that are detailed below.
Fly 390 EMTIPTGDRIFRYY----LRMNVSTVKQHHVDPEECIQKAVSQCYVAQNRMLNLERFHSRECLKD 450
Fly 451 VMVSLSSPKILTYVLSVASRKFMTTCSEIRLCHNKVLVLDGAHVLGM---------MGCLRAVDL 506
Fly 507 SHNWVQDLSSIHSLGNLPLKSLVLHGNKLCRNYRLPSEYVRAVKEVFPQLTTLDGVDLQTNPG-Q 570
Fly 571 SLQKNFLCDTG 581 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
nxf2 | NP_524111.3 | leucine-rich repeat | 434..474 | CDD:275382 | 9/39 (23%) |
leucine-rich repeat | 475..500 | CDD:275382 | 6/33 (18%) | ||
leucine-rich repeat | 501..524 | CDD:275382 | 6/22 (27%) | ||
leucine-rich repeat | 525..555 | CDD:275382 | 8/29 (28%) | ||
TAP_C | 779..841 | CDD:197882 | |||
nxf4 | NP_731156.1 | leucine-rich repeat | 150..190 | CDD:275382 | 10/57 (18%) |
LRR_4 | 189..235 | CDD:289563 | 11/50 (22%) | ||
leucine-rich repeat | 191..216 | CDD:275382 | 5/29 (17%) | ||
leucine-rich repeat | 217..240 | CDD:275382 | 6/22 (27%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C45450005 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG3763 | |
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
3 | 2.740 |