DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nxf2 and nxf4

DIOPT Version :9

Sequence 1:NP_524111.3 Gene:nxf2 / 39843 FlyBaseID:FBgn0036640 Length:841 Species:Drosophila melanogaster
Sequence 2:NP_731156.1 Gene:nxf4 / 40884 FlyBaseID:FBgn0051501 Length:301 Species:Drosophila melanogaster


Alignment Length:206 Identity:47/206 - (22%)
Similarity:89/206 - (43%) Gaps:43/206 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   390 EMTIPTGDRIFRYY----LRMNVSTVKQHHVDPEECIQKAVSQCYVAQNRMLNLERFHSRECLKD 450
            ::.:...||:.:.:    ||::::.|.....||.|              |.|:|..|:..:.|..
  Fly   116 QIWLKVSDRMPKIWINSILRLHLTMVLLDRYDPVE--------------RSLDLTLFYKDKALCG 166

  Fly   451 VMVSLSSPKILTYVLSVASRKFMTTCSEIRLCHNKVLVLDGAHVLGM---------MGCLRAVDL 506
            ...:|:....::.||.:..|:.    .|:     :.|:|||.|:..:         ...|.::.|
  Fly   167 EFFALAESNCMSTVLGIVDREM----PEL-----ERLILDGNHLTNLWVFRKVERRFPRLHSISL 222

  Fly   507 SHNWVQDLSSIHSLGNLPLKSLVLHGNKLCRNYRLPSEYVRAVKEVFPQLTTLDGVDLQTNPG-Q 570
            .||.::::.|:.:|..|||..|.|..|.      ||:.|.:.|.:::|.|..|:.:.:..:|. .
  Fly   223 KHNDIENIYSLRNLQFLPLAELNLLDNP------LPAGYEKEVLDIWPSLQVLNKIQVTPDPAMM 281

  Fly   571 SLQKNFLCDTG 581
            .|.:..|..||
  Fly   282 QLVERVLQHTG 292

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nxf2NP_524111.3 leucine-rich repeat 434..474 CDD:275382 9/39 (23%)
leucine-rich repeat 475..500 CDD:275382 6/33 (18%)
leucine-rich repeat 501..524 CDD:275382 6/22 (27%)
leucine-rich repeat 525..555 CDD:275382 8/29 (28%)
TAP_C 779..841 CDD:197882
nxf4NP_731156.1 leucine-rich repeat 150..190 CDD:275382 10/57 (18%)
LRR_4 189..235 CDD:289563 11/50 (22%)
leucine-rich repeat 191..216 CDD:275382 5/29 (17%)
leucine-rich repeat 217..240 CDD:275382 6/22 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45450005
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3763
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.