DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nxf2 and Nxf3

DIOPT Version :9

Sequence 1:NP_524111.3 Gene:nxf2 / 39843 FlyBaseID:FBgn0036640 Length:841 Species:Drosophila melanogaster
Sequence 2:NP_001287064.2 Gene:Nxf3 / 317878 FlyBaseID:FBgn0263232 Length:615 Species:Drosophila melanogaster


Alignment Length:398 Identity:92/398 - (23%)
Similarity:155/398 - (38%) Gaps:75/398 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   422 IQKAVSQCYVAQNRMLNLERFHSRECLKDVMVSLSSPKILTYVLSVASRKFMTTCSEIRLCHNKV 486
            ||:|:...|...:|.|:|.|||:...|......|...|:|..||.:::..|.         |...
  Fly   179 IQEALRSRYEVDSRTLDLSRFHASPELSLHFCPLHMVKLLETVLVLSNHLFP---------HVTS 234

  Fly   487 LVLDGAHVLGM---------MGCLRAVDLSHNWVQDLSSIHSLGNLPLKSLVLHGNKLCRNYRLP 542
            |||...::..:         ...|..:|:|.|.:|||..::.:..|..|::.|.||.|.:     
  Fly   235 LVLSNNYLCSLKAFAGNSQSFASLERLDISANRIQDLGELNYINKLSCKTIFLAGNGLAK----- 294

  Fly   543 SEYVRAVKEVFPQLTTLDG----------VDLQTNPGQSLQKNFLCDTGAYELVGAFLENYLREF 597
             ..|..::::.|||..:.|          || .....|.||..   .|...:....|:.:|...|
  Fly   295 -LSVDVIRKMLPQLKNVHGCVQLGESTEAVD-NIPKSQQLQGG---GTNGLKFCQDFISSYYTFF 354

  Fly   598 ENDEFRHNLYKYYSENSIFTLTCNYNVVQNHQTPKILQRLSKYNRHARNLRNKDYSKASDG-VFF 661
            ::.|.|..|.|||.:.::|:|:          .|..|..:..|..:.||.:.:..|.|.:. :..
  Fly   355 DDTEERFKLKKYYDDQAMFSLS----------VPVQLNYVYGYKLYNRNQKRQHSSFAQNAKLQV 409

  Fly   662 GCTYIVEILLQLPRVTHDFHSLQTDVMHYNGKGAVIYVAGLLRDEPPSTRNGHGSKTDIGGVLLG 726
            |...::..|.:||.:..|..::..|:..:.....:..:.|..::....|....           .
  Fly   410 GRAALLLALSRLPLMHTDLENVGLDIQVFTSSLRIFTLTGYFKEISSDTLEPR-----------R 463

  Fly   727 FSRQFVVTFDEANLGLGKRARRLKIANERLHIT----NPSKTAIRNAFSVNF--PDPSERQAEED 785
            |.|.||:....:...|        |.|:.|.||    :|.|| |:.....|.  .|||..:..:.
  Fly   464 FQRTFVLQTSNSPGWL--------ITNDMLCITSTMPDPKKT-IKFKPETNMINTDPSVEKINKP 519

  Fly   786 SLDVKDHK 793
            ::.|.|.|
  Fly   520 AVTVLDRK 527

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nxf2NP_524111.3 leucine-rich repeat 434..474 CDD:275382 13/39 (33%)
leucine-rich repeat 475..500 CDD:275382 4/33 (12%)
leucine-rich repeat 501..524 CDD:275382 7/22 (32%)
leucine-rich repeat 525..555 CDD:275382 6/29 (21%)
TAP_C 779..841 CDD:197882 3/15 (20%)
Nxf3NP_001287064.2 leucine-rich repeat 191..231 CDD:275382 13/48 (27%)
PPP1R42 <192..296 CDD:411060 30/118 (25%)
leucine-rich repeat 232..257 CDD:275382 3/24 (13%)
leucine-rich repeat 258..281 CDD:275382 7/22 (32%)
NTF2_like 338..489 CDD:415585 35/179 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45450004
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D442228at33208
OrthoFinder 1 1.000 - - FOG0000862
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10662
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.950

Return to query results.
Submit another query.