DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nxf2 and Nxf7

DIOPT Version :9

Sequence 1:NP_524111.3 Gene:nxf2 / 39843 FlyBaseID:FBgn0036640 Length:841 Species:Drosophila melanogaster
Sequence 2:NP_570958.1 Gene:Nxf7 / 170722 MGIID:2159343 Length:620 Species:Mus musculus


Alignment Length:574 Identity:125/574 - (21%)
Similarity:224/574 - (39%) Gaps:122/574 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   286 NMLHKIFSPLDVEIDLEVDGARIDTNNMWKLPEFENSQHWHAFMIPDPSHEFNQEVFFDFFFIRL 350
            |.:|.:.|.....:|...|..||    .:.:|:|.     .|..:.|.|::.:.| :|....|.:
Mouse   140 NSIHSLCSVPFTPVDFHCDKHRI----QFFVPDFR-----IASALKDISYKIHNE-YFQKIPIFV 194

  Fly   351 DPTLSNFYPCYYKYINTEHVFLVRNCFDQIAHLVNNCNLEMTIPTGDRIFRYYLRMNVSTVKQHH 415
            :|:::              .:.|:|.|.:  ..:....|.|.       .||.:..:...:|:..
Mouse   195 NPSVA--------------PYSVQNRFTK--EEMEQLKLAMR-------KRYDVSQHALCLKKLR 236

  Fly   416 VDPEECIQKAVSQCYVAQNRMLNLERFHSRECLKDVM--VSLSSPKILTYVLSVASRKFMTTCSE 478
            .||:           :.:|.:..:  .:.|.|:...:  :..:.||:|:                
Mouse   237 FDPD-----------LMKNNIHMI--LNHRSCMAATLQIIQENFPKLLS---------------- 272

  Fly   479 IRLCHNKVLVLDG-AHVLGMMGCLRAVDLSHNWVQDLSSIHSLGNLPLKSLVLHGNKLCRNYRLP 542
            :.|..||:..||. ..|:.....|:.::||.|.::.:..:..:..|.|:.|.|.||.||..:...
Mouse   273 LNLSSNKLFQLDSLIDVVKKAPQLKILNLSKNMLRTVWELEKMKGLKLEQLWLEGNPLCSTFPDR 337

  Fly   543 SEYVRAVKEVFPQLTTLDGVDLQTNPGQSLQKN---------FLCDTGAYELVGAFLENYLREFE 598
            |.|:|||.|.||:|:.|||..|......:.|:.         |:........|..||..|...::
Mouse   338 SSYIRAVLECFPELSYLDGRKLLLPTVMNTQERKLMKPCKDIFMGSEVIKNQVHRFLREYYLMYD 402

  Fly   599 NDEFRHNLYKYYSENSIFTLTCNYNVVQNHQTPKILQRLSKYNRHARNLRN-KDYSKASDGVFFG 662
            ::| |..|...|.:.:.|:||..:|     .....|..:..|.:...:::| |::......:.:.
Mouse   403 SEE-RQGLLNIYHDQACFSLTIPFN-----PNDPDLNSMYVYFKDENDMKNFKEFHIQRQLLKYT 461

  Fly   663 CTYIVEILLQLPRVTHDFHSLQTDVMHYNGKGAVIYVAGLLRDEPPSTRNGHGSKTDIGGVLLGF 727
            ...|||.|...|:..|.|.|.|.::...........|.||.::|        |:..:   .:..|
Mouse   462 KQDIVECLRGFPQTLHAFSSFQVNICFQMETMLCFSVCGLFKEE--------GTPKE---CVRAF 515

  Fly   728 SRQFVVTFDEANLGLGKRARRLKIANERLHITNPSKTAIRNAFSVNFPDPSERQAEEDSLDVKDH 792
            .|.|:.....:|         :.|.|::|.:.|||...|.:||.:  |.|:         ...:.
Mouse   516 MRIFIALLGSSN---------MYIVNDQLFVRNPSSEEINSAFVI--PSPT---------SYSNF 560

  Fly   793 KLLLFQE----------VTGLISTWVTSIVEEADWDFERALKLFIQKNADHEIP 836
            ||:|.||          .:|:...|....:|:..||:.||.::|.......:||
Mouse   561 KLVLSQEQQRMVQAFSTQSGMKLEWSQKCLEDNKWDYARAAEVFTMLQTKCKIP 614

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nxf2NP_524111.3 leucine-rich repeat 434..474 CDD:275382 6/41 (15%)
leucine-rich repeat 475..500 CDD:275382 6/25 (24%)
leucine-rich repeat 501..524 CDD:275382 4/22 (18%)
leucine-rich repeat 525..555 CDD:275382 14/29 (48%)
TAP_C 779..841 CDD:197882 15/68 (22%)
Nxf7NP_570958.1 Tap-RNA_bind 119..201 CDD:370331 16/84 (19%)
leucine-rich repeat 227..269 CDD:275382 6/54 (11%)
LRR_8 269..330 CDD:338972 18/76 (24%)
leucine-rich repeat 270..295 CDD:275382 7/40 (18%)
leucine-rich repeat 296..319 CDD:275382 4/22 (18%)
leucine-rich repeat 320..350 CDD:275382 14/29 (48%)
NTF2_like 393..539 CDD:385413 36/171 (21%)
TAP_C 558..619 CDD:197882 15/57 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167837911
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3763
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D442228at33208
OrthoFinder 1 1.000 - - FOG0000862
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10662
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
76.810

Return to query results.
Submit another query.