DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mbf1 and EDF1

DIOPT Version :9

Sequence 1:NP_001261952.1 Gene:mbf1 / 39842 FlyBaseID:FBgn0262732 Length:188 Species:Drosophila melanogaster
Sequence 2:NP_003783.1 Gene:EDF1 / 8721 HGNCID:3164 Length:148 Species:Homo sapiens


Alignment Length:138 Identity:91/138 - (65%)
Similarity:115/138 - (83%) Gaps:0/138 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 SDWDSVTVLRKKAPKSSTLKTESAVNQARRQGVAVDTQQKYGAGTNKQHVTTKNTAKLDRETEEL 66
            ||||:|||||||.|.::..|::.|:..|:|:|..|:|.:|:.||.||||..||||||||||||||
Human     4 SDWDTVTVLRKKGPTAAQAKSKQAILAAQRRGEDVETSKKWAAGQNKQHSITKNTAKLDRETEEL 68

  Fly    67 RHDKIPLDVGKLIQQGRQSKGLSQKDLATKICEKQQVVTDYEAGRGIPNNLILGKMERVLGIKLR 131
            .||::.|:|||:||||||||||:||||||||.||.||:.|||:||.||||.:|||:||.:|:|||
Human    69 HHDRVTLEVGKVIQQGRQSKGLTQKDLATKINEKPQVIADYESGRAIPNNQVLGKIERAIGLKLR 133

  Fly   132 GKERGQPI 139
            ||:.|:||
Human   134 GKDIGKPI 141

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mbf1NP_001261952.1 MBF1 2..70 CDD:285695 41/67 (61%)
aMBF1 12..144 CDD:224726 82/128 (64%)
HTH_3 79..131 CDD:279690 38/51 (75%)
EDF1NP_003783.1 MBF1 5..71 CDD:400707 39/65 (60%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 33..66 21/32 (66%)
Interaction with NR5A2, PPARG and NR1H3. /evidence=ECO:0000269|PubMed:12040021 37..113 54/75 (72%)
aMBF1 <48..142 CDD:331548 69/94 (73%)
Interaction with TBP and NR5A1. /evidence=ECO:0000269|PubMed:10567391 69..108 28/38 (74%)
IQ motif 81..88 6/6 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165160390
Domainoid 1 1.000 92 1.000 Domainoid score I7657
eggNOG 1 0.900 - - E1_COG1813
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H2809
Inparanoid 1 1.050 191 1.000 Inparanoid score I3883
Isobase 1 0.950 - 0 Normalized mean entropy S462
OMA 1 1.010 - - QHG54797
OrthoDB 1 1.010 - - D1571466at2759
OrthoFinder 1 1.000 - - FOG0003409
OrthoInspector 1 1.000 - - oto91533
orthoMCL 1 0.900 - - OOG6_102239
Panther 1 1.100 - - LDO PTHR10245
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R686
SonicParanoid 1 1.000 - - X2304
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1716.750

Return to query results.
Submit another query.